SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000010006 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000010006
Domain Number 1 Region: 31-217
Classification Level Classification E-value
Superfamily vWA-like 2.23e-56
Family Integrin A (or I) domain 0.00018
Further Details:      
 
Domain Number 2 Region: 230-421
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.06e-26
Family Laminin G-like module 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000010006   Gene: ENSMMUG00000007616   Transcript: ENSMMUT00000010665
Sequence length 959
Comment pep:known chromosome:MMUL_1:4:55697762:55829906:-1 gene:ENSMMUG00000007616 transcript:ENSMMUT00000010665 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAHYIAFLCTVLVLLLQNSVLAEDGEVRSSCRTAPTDLVFILDGSYSVGPENFEIVKKWL
VNITKNFDIGPKFIQVGVVQYSDYPVLEIPLGSYDSGEHLTAAVESILYLGGNTRTGKAI
QFALDYLFAKSSRFLTKIAVVLTDGKSQDDVKDAAEAARDSKITLFAIGVGSETEDAELR
AIANKPSSTYVFYVEDYIAISKIREVIKQKLCEESVCPTRIPVAARDERGFDILLGLDVN
KKVKKRIQLSPKKIKGYEVTSKVDLSELTSNVFPEGLPPSYVFVSTQRFKVKKIWDLWRI
LTIDGRPQIAVTLNGVDKILLFTTTSIINGSQVVTFASPQVKTLFDEGWHQIRLLVTEQD
VTLYIDDQQIENKPLHPALGILINGQTQIGKYSGKEETVQFDVQKLRIYCDPEQNNRETA
CEIPGFVMECLNGPSDVGSTPAPCICPPGKPGLQGPKGDPGLPGNPGYPGQPGQDGKPGY
QGIAGTPGVPGSPGIQGARGLPGYKGEPGRDGDKGDRGLPGFPGLHGMPGSKGEMGAKGD
KGSPGFYGKKGSGAKGEKGNAGFPGLPGPAGEPGRHGKDGLMGSPGFKGEAGSPGAPGQD
GTRGEPGIPGFPGNRGLMGQKGEIGPPGQQGKKGAPGMPGLMGSNGSPGQPGTPGSKGSK
GEPGIQGMPGASGLKGEPGAVGSPGEPGYMGLPGIQGKKGDKGNQGEKGIQGQKGDNGRQ
GIPGQQGIQGHHGAKGERGEKGDPGVRGAIGSKGESGVDGLMGPAGPKGQPGDPGPQGPP
GLDGKPGREFSEQFIRQVCTDVIRAQLPVLLQSGRIRNCDHCQSQHGSPGIPGPPGPVGP
EGPRGLPGLPGRDGVPGLMGVPGRPGIRGLKGLPGRNGEKGSQGFGHPGEQGPPGPPGPE
GPPGISKEGPPGDPGLPGKDGDHGKPGIQGQPGPPGICDPSLCFSVIAGRDPFRKGPNY
Download sequence
Identical sequences ENSMMUP00000033516 9544.ENSMMUP00000033516 ENSMMUP00000010006

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]