SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000010131 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000010131
Domain Number 1 Region: 665-780,945-998
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.00000000032
Family FAD/NAD-linked reductases, N-terminal and central domains 0.03
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000010131
Domain Number - Region: 179-247
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 0.00034
Family N-myristoyl transferase, NMT 0.065
Further Details:      
 
Domain Number - Region: 463-569
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 0.000966
Family N-acetyl transferase, NAT 0.021
Further Details:      
 
Domain Number - Region: 737-802,833-905
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.0777
Family FAD/NAD-linked reductases, N-terminal and central domains 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000010131   Gene: ENSMMUG00000011429   Transcript: ENSMMUT00000010800
Sequence length 1237
Comment pep:known chromosome:MMUL_1:10:53369045:53476308:1 gene:ENSMMUG00000011429 transcript:ENSMMUT00000010800 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVLTSPRGKVEVVHCRRTESQDIYCIKSLIRKFTCKLFGKLNIIYLLEKANLAVTLCND
KEEIMAQATFLDYPNWNVAKQDDWVSVFRELDSDIPCTPLNTLFMHLFVAVDEYSVGCCK
EILRTVYKAVPELHFIFLIVPSYMSLGSTLITVFDQVGNIPCLTYEEDFAVHICHRHSHY
PQLHIRKARVEDHDDLMPIFMRYDTILKETYGEYFLAELIEAQDEENHAVVCEVAGTAVG
FMSVCSRVNMQLLHECFDLGPFHGLCFPHPDDVLEAPQELSVRRSQDAELRSSSQGSQKI
VEESQEPVFPDTMENIQGNIAKEAASEEALTAVQSGSVSEPEDIEELSDVSTGYAQDHRV
SSRSLASLLLPEEPVHFRPIYRGASAAFCIQLFCIDEKYEARSLDFMNFVFSLFSDKNFC
IISLPHLTPEFILIQNFVKMVPFSTCTLEQDLYVFHRAGLLKSIHIRFATFLDTPGVENL
VSTLMLNKSILEDLDRYNKARKDPDGTLLQAFVAEVAEQIVGIAVIRNEMDIEYIRSHYN
IEDFIYFSHHQREEHGHMHHFALNPIFRHYTKFFLKEILRLGFKSCLYYPVYPKSREGKF
QNPYAHSLTSALHYLVPVRPRRQIVYPLEKLGINAPSKAVSKDPISYALNHTNRKLTLEP
KITVNAKIIVVGASNVGISFLETLVFCSHLKFNNLTLISTHGLPGKKLLDTEQRKFLASD
HCFNDKDYALMSLCSWVNVVVGRMTGIDRAAKHVVLSTGEIVLYDHLILCTGQQYQVPCP
TGADISQHLTNREVPNSSQRRYTGKVPCNHFTLNEEEDCFKALTWIRNNSITTEGNVIVY
GNTIDTYTTVETLLNLGVSGSRVHLVQPPPASTITCINNYSVESAVADALAAAGVTIYRD
AILAQWNDGLHPDPIYSASFTTPTKPFRLPCSMFFSFCEKNVDYETFKALNDTCLVYDGR
LVIDTNFHTNDIAIRAAGSLTKFSNRYYSNEWTHSNFSSKEIGFQLAAAMLHLFDPTLEP
VTEPPADLDRLIPMYKGAKIQGGILPGSYHYLHIAKPAIPTPLEVQMAQPNYGLEIVTGN
AKNGTYFRIHINKYKMVETITCLSREPFPTSNYIRLFGQHEQLLNNLCARYDENLITDLY
SYFTEPWCLALFHDRFIDLRKELRQILASKEGEDLPSIEQLAHQIEDEEINPTEKPRQYL
KRVFEESIYKTLVERSTLDYLHYNRYHLPMYAWPGII
Download sequence
Identical sequences NP_001180866.1.72884 XP_001091948.1.72884 ENSMMUP00000037413 9544.ENSMMUP00000037413 ENSMMUP00000010131

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]