SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000010142 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000010142
Domain Number 1 Region: 287-416
Classification Level Classification E-value
Superfamily PH domain-like 2.34e-34
Family Phosphotyrosine-binding domain (PTB) 0.0000107
Further Details:      
 
Domain Number 2 Region: 95-246
Classification Level Classification E-value
Superfamily PH domain-like 1.23e-29
Family Phosphotyrosine-binding domain (PTB) 0.0094
Further Details:      
 
Domain Number 3 Region: 3-44
Classification Level Classification E-value
Superfamily WW domain 0.0000000000682
Family WW domain 0.0000682
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000010142   Gene: ENSMMUG00000007723   Transcript: ENSMMUT00000010812
Sequence length 469
Comment pep:known chromosome:MMUL_1:14:65798915:65807710:1 gene:ENSMMUG00000007723 transcript:ENSMMUT00000010812 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DSFWNPNAFETDSDLPAGWMRVQDTSGTYYWHIPTGTTQWEPPGRASPSQGSSPQEESQL
TWTGFAHGEGFEDGEFWKDEPSDEAPMELGLKEPEEGTLTFPAQSLSPEPLPQEEEKLPP
RNTNPGIKCFAVRSLGWVEMTEEELAPGRSSVAVNNCIRQLSYHKNNLHDPMSGGWGEGK
DLLLQLEDETLKLVEPQSQALLHAQPIISIRVWGVGRDSGRERDFAYVARDKLTQMLKCH
VFRCTAPSTPWTSCHLHSTRIMAERRNARCLVNGLSLDHSKLVDVPFQVEFPAPKNELVQ
KFQVYYLGNVPVAKPVGVDVINGALESVLSSSSREQWTPSHVSVAPATLTILHQQTEAVL
GECRVRFLSFLAVGRDVHTFAFIMAAGPASFCCHMFWCEPNAASLSEAVQAACMVEQEEL
AQARPHTPPSRGRRKGLVQAWVPSLCSVGTSTVLISLIKSVCTAKKKKD
Download sequence
Identical sequences ENSMMUP00000036908 9544.ENSMMUP00000036908 ENSMMUP00000010142

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]