SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000010216 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000010216
Domain Number 1 Region: 3-126
Classification Level Classification E-value
Superfamily NTF2-like 7.17e-43
Family NTF2-like 0.000000717
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000010216   Gene: ENSMMUG00000007774   Transcript: ENSMMUT00000010889
Sequence length 127
Comment pep:known chromosome:MMUL_1:1:115738895:115739765:1 gene:ENSMMUG00000007774 transcript:ENSMMUT00000010889 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGDKPVWEPIGSSFIQHYYQLFGNDRTQLSAVYIDASCLTWEGQQFQGKAAIVEKLSSLP
FQKIQHSLMAQDHQPIPDSFIISMVVGQLKADKDPIMGFHQMFLLKNIQVAWVCTDDMFR
LALHNFG
Download sequence
Identical sequences ENSMMUP00000010216 ENSMMUP00000010216 9544.ENSMMUP00000010216 XP_001108784.1.72884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]