SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000010239 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000010239
Domain Number 1 Region: 46-89
Classification Level Classification E-value
Superfamily WW domain 0.00000000341
Family WW domain 0.0032
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000010239
Domain Number - Region: 1294-1339
Classification Level Classification E-value
Superfamily PKD domain 0.0615
Family PKD domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000010239   Gene: ENSMMUG00000007791   Transcript: ENSMMUT00000010914
Sequence length 1459
Comment pep:known chromosome:MMUL_1:14:115759643:115799266:1 gene:ENSMMUG00000007791 transcript:ENSMMUT00000010914 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGRPLRIGDQLVLEEDYDETYIPSEQEILEFAREIGIDPIKEPELMWLAREGIVAPLPG
EWKPCQDITGDIYYFNFANGQSMWDHPCDEHYRNLVIQERAKLSTSGAVKKKKKKKEKKD
KKDKETPKSSLALGSSLAPVHVPLGGLAPLRGLVDTPPSALRGSQSVSLGSSVESGRQLG
ELMLPSQGLKTSAYTKGLLGSIHEDKTALSLLALGEETNEEDEEESDNQSIHSSSEPLKN
LHLDIGALGVDFEYEESLRTSQPEEKDVSLDSAAASPPTPCKPSSPGADSNLSSADGKGR
QGSGARPGLPEKEENEKSEPKISRNLVTSKADPRGNDPAEASEKEAPEDTVDAGEEGSRR
EEAAKEPKKKASALEKGSSDASQELEISEHMKEPQLSDSITSDPKSFHGLDFGFHSRISE
HLLDIDVLSPALDGTRWQAQQPLGIEDKNDSQSSQDELQSKQSKGLERLSPPLPHEERAQ
SPPRSLATEEEPPQGPEGQPEWKEAEKPGEDSAASLSPQLSLQREQAPSPPAAHEKGTEQ
HSQAEELGPGQEEAEENEEKVAVSPTPLVSPEVRFTEPVAPPKQLSEAALKAMEEAVAQV
LEQDQRHLLESKQEKMQQLREKLCQEEEEEILRLHQQKEQSLSSLRERLQKASEEEEARM
REEESQRLSWLRAQIQSSTQADEDQIRAEQEASLQKLREELESQQKAERASLEQKNRQTL
EQLKEEMEASEKTEQAALNAAKEKALQQLREQLEGERKEAVARLEKEHGAELERLCSSLE
AKHQEVVSSLQKKIEEAQQKEEAQLQKCLGQVEHRVHQKAYHMAEYEQELSSLLREKRQE
VEGEHERRLDKMKEEHQQVMAKAREQYEAEERKQRAELLGHLTGELERLQRAHERELETV
RQEQHKRLEDLRRRHREQERKLQDLELDLETRAKDVKARLALLEVQEETARREKQQLLDV
QRQVALKSEEATATHQQLEEAQKEHTHLLQSNQQLRKILDELQARKLKLESEVDLLQAQS
QQLQKHISSLEAEAQKKQHLLREVTVEEKNVSPHFEPDLHIEDLRKSLGTNQTKEVSSLS
QSQEDLYLNSLSSHNVWHLLSTEGVALRSAKEFLVRQTHSMRRRQTALKAAQQHWRHELA
SAQEVAKDPPGIKALEDMRKNLEKETRHLDEMKSAMRKGHSLLKKKEEKLNQLESSLWEE
ASDEGTLGGSPTKKAVTFDLSDMDSLSSESSESCSLPHCEWWWQQRNDFDSTPGLTSRKI
HGLSHSLRQISSQLSSVLSILDSLNPQSPPPLLASTPAQLPPRASKSTPTPTYYGSLARF
SALSSATPTSTQWAWDSGQGPRLPSSVAQTVDDFLLEKWRKYFPSGIPLLSNSPAPLESR
LGYVSASEQLRLLQHSHSQVPEVGSTTFQGIIEANRRWLERVKNDPKLPLFSSTPKPTAT
LSLLQLGLDEHNRVKVYRF
Download sequence
Identical sequences ENSMMUP00000010241 ENSMMUP00000010239 9544.ENSMMUP00000010241

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]