SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000010242 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000010242
Domain Number 1 Region: 843-1043
Classification Level Classification E-value
Superfamily Fibronectin type III 1.24e-39
Family Fibronectin type III 0.00098
Further Details:      
 
Domain Number 2 Region: 697-845
Classification Level Classification E-value
Superfamily Fibronectin type III 4.65e-32
Family Fibronectin type III 0.00000151
Further Details:      
 
Domain Number 3 Region: 1-73
Classification Level Classification E-value
Superfamily Immunoglobulin 1.95e-20
Family I set domains 0.012
Further Details:      
 
Domain Number 4 Region: 442-545
Classification Level Classification E-value
Superfamily Immunoglobulin 1.96e-20
Family I set domains 0.022
Further Details:      
 
Domain Number 5 Region: 352-452
Classification Level Classification E-value
Superfamily Immunoglobulin 4.02e-20
Family I set domains 0.022
Further Details:      
 
Domain Number 6 Region: 167-267
Classification Level Classification E-value
Superfamily Immunoglobulin 2.36e-19
Family I set domains 0.009
Further Details:      
 
Domain Number 7 Region: 1044-1143
Classification Level Classification E-value
Superfamily Immunoglobulin 5.65e-19
Family I set domains 0.014
Further Details:      
 
Domain Number 8 Region: 68-155
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000195
Family I set domains 0.028
Further Details:      
 
Domain Number 9 Region: 268-358
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000417
Family I set domains 0.052
Further Details:      
 
Domain Number 10 Region: 1240-1314
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000114
Family Fibronectin type III 0.0045
Further Details:      
 
Domain Number 11 Region: 540-588
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000391
Family C1 set domains (antibody constant domain-like) 0.07
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000010242
Domain Number - Region: 1136-1170
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000588
Family Fibronectin type III 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000010242   Gene: ENSMMUG00000007794   Transcript: ENSMMUT00000010917
Sequence length 1805
Comment pep:known chromosome:MMUL_1:14:115832280:115924443:-1 gene:ENSMMUG00000007794 transcript:ENSMMUT00000010917 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TVELPCTASGYPIPAIRWLKDGRPLPADSRWTKRITGLTISDLRTEDSGTYICEVTNTFG
SAEATGILTVIDPLHVTLTPKKLKTGIGSTVILSCALTGSPEFTIRWYRNTELVLPDEAI
SIRGLSNETLLITSAQKSHSGAYQCFATRKAQTAQDFAIIALEDGTPRIVSSFSEKVVNP
GEQFSLMCAAKGAPPPTVTWALDDEPIVRDGSHRTNQYTMSDGTTISHMNVTGPQIRDGG
VYRCTARNSVGSAEYQARINVRGPPSIRAMRNITAVAGRDTLINCRVIGYPYYSIKWYKD
ALLLPDNHRQVVFENGTLKLTDVQKGMDEGEYLCSVLIQPQLSISQSVHVAVKVPPLIQP
FEFPPASIGQLLYIPCVVSSGDMPIRITWRKDGQVIISGSGVTIESKEFMSSLQISSVSL
KHNGNYTCIASNAAATVSRERQLIVRVPPRFVVQPNNQDGIYGKAGVLNCSVDGYPPPKV
MWKHAKGSGNPQQYHPVPLTGRIQILPNSSLLIRHVLEEDIGYYLCQASNGVGTDISKSM
FLTVKIPAMITSHPNTTIAIKGHAKELNCTARGERPIIIRWEKGDTVIDPDRVMRYAIAT
KDNGDEVVSTLKVSPRVNGEHLNCPMLHLAHHRCSVNISASSPDTPPQVEYSGMISAHCN
LRLPDSSNSPSAWLCSDIGAFSPDSWDFKQSTRNISPTINQANIVDLHPASVYSIRMYSF
NKIGRSEPSKELTISTEEAAPDGPPMDVTLQPVTSQSIQVTWKAPKKELQNGVIRGYQIG
YRENSPGSNGQYSIVEMKATGDSEVYTLDNLKKFAQYGVVVQAFNRAGTGPSSSEINATT
LEDVPSQPPENVRALSITSDVAVISWSEPPRSTLNGVLKGYRVIFWSLYVDGEWGEMQNI
TTTRERVELRGMEKFTNYSVQVLAYTQAGDGVRSSVLYIQTKEDVPGPPAGIKAVPSSAS
SVVVSWLPPTKPNGVIRKYTIFCSSPGSGQPAPSEYETSPEQLFYRIAHLNRGQQYLLWV
AAVTSAGRGNSSEKVTIEPAGKAPAKIISFGGTVTTPWMKDVRLPCNSVGDPAPAVKWTK
DSEDSAIPVSMDGHRLIHTNGTLLLRAVKAEDSGYYTCTATNTGGFDTIIVNLLVQVPPD
QPRLTVSKTSASSITLTWIPGDNGGSSIRGEECHLGFSTPAPPMLLPVSLSVWVSQSVKV
DKWTRSVLSKHECASASPTGLVLLSLLLRGPCVNKDQHLFTHINSTHARLNLQGWNNGGC
PITAIVLEYRPKGTWAWQGLRANSSGEVFLTELREATWYELRMRACNSAGCGNETAQFAT
LDYDGSTIPPIKSAQGEGDDVKKLFTIGCPVILATLGVALLFIVRKKRKEKRLKRLRDAK
SLAEMLISKNNRSFDTPVKGPPQGPRLHIDIPRVQLLIEDKEGIKQLGDDKATIPVTDAE
FSQAVNPQSFCTGVSLHHPALIQSTGPLIDMSDIRPGTNPVSRKNVKSAHSTRNRYSSQW
TLTKCQASTPARTLTSDWRTVGSQHGVTVTESDSYSASLSQDTDKGRNSMVSTESASSTY
EELARAYEHAKLEEQLQHAKFEITECFISDSSSDQMTTGTNENADSMTSMSTPSEPGICR
FTASPPKPQDADRGKNVAVPIPHRANKSDYCNLPLYAKSEAFFRKADGREPCPVVPPREA
SIRNLARTYHTQARHLTLDPASKPLGLPHPGAPAAASTATLPQRTLAMPAPPAGTAPPAP
GPTPAEPPTAPSAAPPAPSTEPPRAGGPHTKMGGSRDSLLEMSTSGVGRSQKQGAGAYSK
SYTLV
Download sequence
Identical sequences 9544.ENSMMUP00000010242 ENSMMUP00000010242 ENSMMUP00000010242

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]