SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000010250 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000010250
Domain Number 1 Region: 185-260
Classification Level Classification E-value
Superfamily SH3-domain 2.23e-20
Family SH3-domain 0.0000889
Further Details:      
 
Domain Number 2 Region: 2-30
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000201
Family LASP-1 0.0028
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000010250
Domain Number - Region: 32-59
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000254
Family LIM domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000010250   Gene: ENSMMUG00000007799   Transcript: ENSMMUT00000010925
Sequence length 261
Comment pep:known chromosome:MMUL_1:16:48911438:48964553:1 gene:ENSMMUG00000007799 transcript:ENSMMUT00000010925 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNPNCARCGKIVYPTEKVNCLDKFWHKACFHCETCKMTLNMKNYKGYEKKPYCNAHYPKQ
SFTMVADTPENLRLKQQSELQSQVRYKEEFEKNKGKGFSVVADTPELQRIKKTQDQISNI
KYHEEFEKSRMGPSGGEGMEPERRDSQESSSYRRPPEQQQPHHIPTSAPVYQQPQQQPVA
QSYGGYKEPAAPVSIQRSAPGGGGKRYRAVYDYSAADEDEVSFQDGDTIINVQQIDDGWM
YGTVERTGDTGMLPANYVEAI
Download sequence
Identical sequences A0A096P590 A0A2K5JWA4 A0A2K5ML38 A0A2K5TJK1 A0A2K6DCU5 A0A2K6N5N2 A0A2K6R9B5 F7CPT5
9544.ENSMMUP00000010250 ENSMMUP00000010250 ENSMMUP00000010250 ENSPANP00000020515 NP_001252802.1.72884 XP_005584047.1.63531 XP_010377633.1.97406 XP_011723655.1.29376 XP_011815211.1.43180 XP_011901791.1.92194 XP_017734492.1.44346

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]