SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000010257 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000010257
Domain Number 1 Region: 48-235
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.78e-45
Family SPRY domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000010257   Gene: ENSMMUG00000007804   Transcript: ENSMMUT00000010932
Sequence length 620
Comment pep:known chromosome:MMUL_1:20:66044254:66133117:-1 gene:ENSMMUG00000007804 transcript:ENSMMUT00000010932 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAATADPGAGNPQAGDSSGGGAGGGLPSPGEQELSRRLQRLYPAVNQQETPLPRSWSPK
DKYNYIGLSQGNLRVHYKGHGKNHKDAASVRATHPIPAACGIYYFEVKIVSKGRDGYMGI
GLSAQGVNMNRLPGWDKHSYGYHGDDGHSFCSSGTGQPYGPTFTTGDVIGCCVNLINGTC
FYTKNGHSLGIAFTDLPANLYPTVGLQTPGEIVDANFGQQPFLFDIEDYMREWRAKVQGT
VHCFPISARLGEWQAVLQNMVSSYLVHHGYCATATAFARMTETPIQEEQASIKNRQKIQK
LVLEGRVGEAIETTQRFYPGLLEHNPNLLFMLKCRQFVEMVNGTDSEVRSLSSRSPKSQD
SYPGSPSLSPRHGPSSSHMHNTGADSPSCSNGVVSTKSKQNHSKYPAPSSSSSSSSSSSS
SSPSSINYSESNSTDSTKSQPHSSTSNQETSDSEMEMEAEHYPNGVLGSMSTRIVNGAYK
HEDLQTDESSMDDGHPRRQLCGGNQAATERIILFGRELQALSEQLGREYGNNLAHTEMLQ
DAFSLLAYSDPWSCPVGQQLDPIQREPVCAALNSAILESQNLPKQPPLMLALGQASECLR
LMARAGLGSCSFARVDDYLH
Download sequence
Identical sequences G7Q1E6 I2CV23
NP_001253764.1.72884 XP_005592346.1.63531 9544.ENSMMUP00000010257 ENSMMUP00000010257 ENSMMUP00000010257

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]