SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000010265 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000010265
Domain Number 1 Region: 17-305
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 7.85e-72
Family FCH domain 0.0015
Further Details:      
 
Domain Number 2 Region: 382-443
Classification Level Classification E-value
Superfamily SH3-domain 2.36e-19
Family SH3-domain 0.0008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000010265   Gene: ENSMMUG00000007811   Transcript: ENSMMUT00000010941
Sequence length 444
Comment pep:known chromosome:MMUL_1:4:34187050:34255711:1 gene:ENSMMUG00000007811 transcript:ENSMMUT00000010941 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGSYDEASLAPEETTDSFWEVGNYKRTVKRIDDGHRLCNDLMNCVQERAKIEKAYGQQL
TDWAKRWRQLIEKGPQYGSLERAWGAIMTEADKVSELHQEVKNNLLNEDLEKVKNWQKDA
YHKQIMGGFKETKEAEDGFRKAQKPWAKKMKELEAAKKSYHLACKEEKLAMTREMNSKTE
QSVTPEQQKKLQDKVDKCKQDVQKTQEKYEKVLEDVGKTTPQYMENMEQVFEQCQQFEEK
RLVFLKEVLLDIKRHLNLAENSSYIHVYRELEQAIRGADAQEDLRWFRSTSGPGMPMNRT
QFEEWNPDLPHTTTKKEKQSKKAEGVALTNATGAVESTSQAGDRGSVSSYDRGQPYATEW
SDDESGNPFGGSEANGGANPFEDDSKGVRVRALYDYDGQEQDELSFKAGDELTKLGEEDE
QGWCRGRLDSGQLGLYPANYVEAI
Download sequence
Identical sequences ENSMMUP00000010265 ENSMMUP00000010265 9544.ENSMMUP00000010265

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]