SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000010271 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000010271
Domain Number 1 Region: 142-459
Classification Level Classification E-value
Superfamily Cysteine proteinases 4.25e-123
Family Transglutaminase core 0.0000000000164
Further Details:      
 
Domain Number 2 Region: 4-139
Classification Level Classification E-value
Superfamily E set domains 9.8e-42
Family Transglutaminase N-terminal domain 0.000000346
Further Details:      
 
Domain Number 3 Region: 482-594
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 2.22e-31
Family Transglutaminase, two C-terminal domains 0.000000952
Further Details:      
 
Domain Number 4 Region: 594-692
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 1.19e-26
Family Transglutaminase, two C-terminal domains 0.00000282
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000010271   Gene: ENSMMUG00000007819   Transcript: ENSMMUT00000010950
Sequence length 693
Comment pep:known chromosome:MMUL_1:10:35608533:35653888:1 gene:ENSMMUG00000007819 transcript:ENSMMUT00000010950 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAALGLQSINWQTAFNRQAHHTHKFSSRELILRRGQNFQVLMLMNKGLGSNERLEFIVST
GPYPSESAMTKAVFPLSNGSSGGWSAVLQAINGNTLTISISSPASAPIGQYTMALQISSQ
GGVSSVKLGTFILLFNPWLNADSVFMGNHAEREEYVQEDAGIIYVGSTNRISMIGWNFGQ
FEEDILSICLSILDRSLNFRRDPATDVARRNDPKYVGRVLSAMINSNDDNGVLAGNWSGT
YTGGRDPRNWNGSVEILKDWKKSGFSPVRYGQCWVFAGTLNTALRSLGIPSRVITNFSSA
HDTDRNLSVDVYYDRMGNPLDKGSDSVWNFHVWNEGWFVRSDLGPSYGGWQVLDATPQER
SQGVFQCGPASVIGIREGDVNLNFDMPFIFAEVNADRITWLYDGTTGRQTKNSVDTRTIG
RYISTKAVGSNARMDVTDKYKYPEGSDQERRVFQKALGKLKPNASFGATSSMGLEAEERE
SSIIGKFKVTGMLAVGKEVNLVLLLKNLSSDTKTVTVNMTAWTIVYNGTLVHEVWKDSAT
MSLDPEEEAEHPVKISYAQYEKYLKSDNMIRITAVCKVPDEPGVVVERDIILDNPTLTLE
VLDEARVRKPVNVQMLFSNPLDEPVRDCVLMVEGSGLLLGNLKIDVPTLRPKERSRVRFE
ILPTRSGTKQLLADFSCNKFHAIKAMLSIDVVE
Download sequence
Identical sequences F7CIV3
9544.ENSMMUP00000010271 ENSMMUP00000010271 ENSMMUP00000010271

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]