SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000010301 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000010301
Domain Number 1 Region: 6-61
Classification Level Classification E-value
Superfamily Chromo domain-like 1.37e-18
Family Chromo domain 0.00098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000010301   Gene: ENSMMUG00000007845   Transcript: ENSMMUT00000010983
Sequence length 251
Comment pep:known chromosome:MMUL_1:10:83034521:83056336:-1 gene:ENSMMUG00000007845 transcript:ENSMMUT00000010983 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELSAIGEQVFAVESIRKKRVRKGKVEYLVKWKGWPPKYSTWEPEEHILDPRLVMAYEEK
EERDRASGYRKRGPKPKRLLLQRLYSMDLRSSHKAKGKEKLCFSLTCPLGSGSPEGVVKA
GAPELVDKGPLVPTLPFPLRKPRKAHKYLRLSRKKFPPRGPNLESHSHRRELFLQEPPAP
DVLQAAGEWEPAAQPPEEEADADLAEGPPPWTPALPSSEVTVTDITANSITVTFREAQAA
EGFFRDRSGKF
Download sequence
Identical sequences A0A024R1Q2 A0A2I3MMH4 A0A2K5IP19 A0A2K5WF83 A0A2K6E3H8 A0A2K6PS30 F7BE16 K7D9H5 O95931
ENSP00000216133 NP_001247702.1.72884 NP_783640.1.87134 NP_783640.1.92137 XP_004063539.1.27298 XP_005567302.1.63531 XP_010387562.1.97406 XP_010387563.1.97406 XP_011710620.1.29376 XP_011819592.1.43180 XP_017715349.1.44346 XP_515139.2.37143 ENSMMUP00000010301 gi|28372505|ref|NP_783640.1| ENSPTRP00000024790 9544.ENSMMUP00000010301 9598.ENSPTRP00000024790 9606.ENSP00000216133 ENSPTRP00000024790 ENSGGOP00000004773 ENSMMUP00000010301 HR6495 ENSGGOP00000004773 ENSPANP00000013357 ENSP00000216133 ENSP00000216133

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]