SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000010339 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000010339
Domain Number 1 Region: 134-407
Classification Level Classification E-value
Superfamily Glutamine synthetase/guanido kinase 1.32e-111
Family Guanido kinase catalytic domain 0.0000000000806
Further Details:      
 
Domain Number 2 Region: 38-134
Classification Level Classification E-value
Superfamily Guanido kinase N-terminal domain 1.01e-41
Family Guanido kinase N-terminal domain 0.000000915
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000010339   Gene: ENSMMUG00000007870   Transcript: ENSMMUT00000011026
Sequence length 413
Comment pep:known chromosome:MMUL_1:7:22036994:22043244:1 gene:ENSMMUG00000007870 transcript:ENSMMUT00000011026 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FSRLLSARPGIRLLALAGAGSLAAGFLLRPEPVRAASERRRLYPPSAEYPDLRKHNNCMA
SHLTPAVYARLCDKTTPTGWTLDQCIQTGVDNPGHPFIKTVGMVAGDEETYEVFADLFDP
VIQERHNGYDPRTMKHTTDLDASKIRSGYFDERYVLSSRVRTGRSIRGLSLPPACTRAER
REVERVVVDALSGLKGDLAGRYYRLSEMTEAEQQQLIDDHFLFDKPVSPLLTAAGMARDW
PDARGIWHNNEKSFLIWVNEEDHTRVISMEKGGNMKRVFERFCRGLKEVEQLIQERGWEF
MWNERLGYILTCPSNLGTGLRAGVHIKLPLLSKDSRFPKILENLRLQKRGTGGVDTAATG
GVFDISNLDRLGKSEVELVQLVIDGVNYLIDCERRLERGQDIRIPTPVIHTKH
Download sequence
Identical sequences 9544.ENSMMUP00000010339 ENSMMUP00000010339 ENSMMUP00000010339

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]