SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000010384 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000010384
Domain Number 1 Region: 196-394
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.14e-58
Family Reprolysin-like 0.0000277
Further Details:      
 
Domain Number 2 Region: 411-485
Classification Level Classification E-value
Superfamily Blood coagulation inhibitor (disintegrin) 4.95e-20
Family Blood coagulation inhibitor (disintegrin) 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000010384   Gene: ENSMMUG00000007909   Transcript: ENSMMUT00000011074
Sequence length 754
Comment pep:known chromosome:MMUL_1:8:24559097:24620939:1 gene:ENSMMUG00000007909 transcript:ENSMMUT00000011074 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLPGCIFLMILLILQVKEKVILGVEGQQLVHPKKLPLMQKRDIGHTHDDDIEETYEEELM
YEIKLNRKTLVLHLLRSREFLGSNYSETFYSMKGEAFTRHLQIMDHCFYQGSIVHEYDSA
ASISTCNGLRGFFRVNDQRYLIEPVKYSDEGEHLVFKYNPRVPYVANYSCTELNFTRKTV
PGDTESEGDPKMKAIHNEKYIELFIVADDTVYRRNSHPHNKLRNRIWGMVNFVNMIYKTL
NIHVTLVGIEIWTHEDKIELHSNIETTLLRFSSWQERILKTRKDFDHVVLLSGKWIYTHV
QGISYPAGMCLPYYSTSIIKDLLPDTNIIANRMAHQLGHNLGMQHDEFPCTCPSGKCVMD
SDGSIPALKFSKCSQNQYHQYLKDYKPTCMLNIPFPCNFDDFQFCGNKKLDEGEECDCGP
PQECTNPCCDAHTCVLKPGFTCAEGECCESCQIKKAGSICRPAEDECDFPEMCTGHSPAC
PKDQFRVNGFPCKNSEGYCFMGKCPTRRDQCSELFDDDDGLYFSVIALEIQKKYNNFTFC
TDSSQNLDLEKEDVRCGKIYCTGGELSYLLGEDKTYHLKDPQQNATVKCKTIFLYHDSTD
IGLVASGTKCGDGMVCNNGECLNMEKVYNSTNCPSQCHENPMDDHGLQCHCEEGQAPVAW
EETLNVTNVAILIVVLVLVIVGIGVLILLIRYQKCIKLKQVQSPPMETLGVENKGYFGDE
QQMRTEPILPEIHFLNKPASKDSRGIADPNQSAK
Download sequence
Identical sequences ENSMMUP00000010384 9544.ENSMMUP00000010384 ENSMMUP00000010384

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]