SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000010423 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000010423
Domain Number 1 Region: 64-308,410-472
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.55e-40
Family FAD-linked reductases, N-terminal domain 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000010423   Gene: ENSMMUG00000007944   Transcript: ENSMMUT00000011115
Sequence length 480
Comment pep:known chromosome:MMUL_1:14:124413823:124423807:1 gene:ENSMMUG00000007944 transcript:ENSMMUT00000011115 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIRRVLPHGLGRGLLTRRPGTRRGGFSLDWDGKVSEIKKKIKSILPGTPCDVLPDTSHLP
PEHSDVVIVGGGVLGLSVAYWLKQLENRRGGMQVLVVERDHTYSQASTGLSVGGICQQFS
LPENIQLSLFSASFLRNINEYLAVTNAPPLDLQFNPSGYLLLASEKDAAAMESNVKVQKQ
EGAKVCLMSPDQLRNKFPWINTEGVALASYGMENEGWFDPWCLLHGLRQKLMSMGVFFCQ
GEVTRFVTSSQRMMTTDDEMVTLKSIHEVHVKMDHSLEYQPVECAIVINAAGAWSAQIAA
LAGIGKGPPGTLQGTKLPVEPRKSVASHPVSVIGNRTXRIRGFSGGLRAVLIDIRAPSRF
EEEEPDPANLEVDHDFFQEKVWPHLALRVPAFETLKVQTAWAGYYDYNTFDQNGVVGPHP
LVVNMYFATGFSGHGLQQAPGVGRAVAEMILEGSFQTIDLSPFLFNRFYLGEKTQENNIM
Download sequence
Identical sequences ENSMMUP00000036594 ENSMMUP00000010423 9544.ENSMMUP00000036594

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]