SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000010473 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000010473
Domain Number 1 Region: 116-299
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.54e-65
Family SPRY domain 0.0000000566
Further Details:      
 
Domain Number 2 Region: 30-103
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000177
Family RING finger domain, C3HC4 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000010473   Gene: ENSMMUG00000028712   Transcript: ENSMMUT00000011168
Sequence length 315
Comment pep:known chromosome:MMUL_1:19:61792099:61793683:-1 gene:ENSMMUG00000028712 transcript:ENSMMUT00000011168 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPFIPMGITNIRSSAPQIIYICIYTFAMAEHFKQIIRCPVCLKDLEEAVQLKCGYVCCLQ
CLNSLQKEPNGEGLLCCLCSVVSQKNDIKPKYKLRALVSIIKELEPKLKSILTMNPKMRK
FQVDMTLDVDTANNYLIISEDLRSVRCGNFRQNRKEQAERFDSALCVLGVPRFTSGRHYW
EVDVGTSKVWDVGVCKESVNRQGNIILSSELGFWTVGCRKGKVFAASTMPLTPLWVSPQL
RRVGIFLDVGMRSISFYNVSDGCHMYTFNKIPVSEPLRPFFSHKLETQDDQSFLSICPVI
PPDSASAPVYSGESK
Download sequence
Identical sequences ENSMMUP00000010473 ENSMMUP00000010473 9544.ENSMMUP00000010473

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]