SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000010474 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000010474
Domain Number 1 Region: 98-280
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.54e-62
Family SPRY domain 0.000000208
Further Details:      
 
Domain Number 2 Region: 13-87
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000000862
Family RING finger domain, C3HC4 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000010474   Gene: ENSMMUG00000007987   Transcript: ENSMMUT00000011170
Sequence length 297
Comment pep:known chromosome:MMUL_1:19:61808671:61810065:1 gene:ENSMMUG00000007987 transcript:ENSMMUT00000011170 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PMPIYSQAVAMAEHFKAASSCPVCLDYLENPMHLKCGYICCLRCMNSLRKGPDGKGVLCP
FCPVVSQKNDIRPAAQLGALVSKIKELEPKLRAALQMNPRMRKFQVDMTLDVDTANNYLI
ISEDLRRVRCGNFRQNRKEQAERFDSALCVLGVPRFTSGRHYWEVDVGTSKVWDVGVCKE
SVNRQGNVVLSSELGFWTVGLREGHIYFASTKPLTGLWVSPGLHRVGIYLDITMRVISFY
NVGDGSHIFTFTKISATEPLRPCFAHADTSRDDHGYLSVCVINNSIASSPVYPGHGN
Download sequence
Identical sequences ENSMMUP00000010474 ENSMMUP00000010474 9544.ENSMMUP00000010474

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]