SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000010569 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000010569
Domain Number 1 Region: 177-234
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.36e-24
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 2 Region: 119-178
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.78e-20
Family Classic zinc finger, C2H2 0.0058
Further Details:      
 
Domain Number 3 Region: 221-278
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.34e-17
Family Classic zinc finger, C2H2 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000010569   Gene: ENSMMUG00000008066   Transcript: ENSMMUT00000011278
Sequence length 278
Comment pep:known chromosome:MMUL_1:4:27126342:27127258:-1 gene:ENSMMUG00000008066 transcript:ENSMMUT00000011278 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVLNVARHSVVVHTLLSIKEFTPVRSPVNVLNVAKLLIRTHILLYIRESILERNLMNAM
NVVGPLVRVHILLSIKECIQEKNPMNVMNVRKPSMITQLLFNIILSILQRNPMNVMTKAF
SYCSDLFQHQRMHTGEKPCQCNECGNAFTFGNYSAVIRHQRTHTGEKPYECKQCGKAFSR
STYLTQHRRSHTREKPYKCNECEKTFSQSSFLTQHTRVHTGEKPYKCNECGKAFSDRSGH
IQRTHTGEKPCECNDCGKPFSFCSPLIQHKRNHTRKKP
Download sequence
Identical sequences ENSMMUP00000010569 9544.ENSMMUP00000010569 ENSMMUP00000010569

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]