SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000010579 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000010579
Domain Number 1 Region: 412-476,514-612
Classification Level Classification E-value
Superfamily PH domain-like 3.01e-31
Family Pleckstrin-homology domain (PH domain) 0.0092
Further Details:      
 
Domain Number 2 Region: 619-736
Classification Level Classification E-value
Superfamily PH domain-like 1.76e-19
Family Pleckstrin-homology domain (PH domain) 0.019
Further Details:      
 
Domain Number 3 Region: 1032-1166
Classification Level Classification E-value
Superfamily Second domain of FERM 0.0000000000000824
Family Second domain of FERM 0.0048
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000010579
Domain Number - Region: 932-1011
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000334
Family First domain of FERM 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000010579   Gene: ENSMMUG00000008074   Transcript: ENSMMUT00000011290
Sequence length 1310
Comment pep:known chromosome:MMUL_1:13:43795345:43843203:1 gene:ENSMMUG00000008074 transcript:ENSMMUT00000011290 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VQVMEDKLKAANIQTSESETRLYNKCQDLESLIQEKDDIIQNLELQLEEQKQIRIQEAKI
IEEKAAKIKEWVTVKLNELELENQNLRLINQNQTEEIRTMQSKLQEFQIRTVNFLFVPKF
GARQHADMMYPFLEMEIPEKSVDNQVLENNRGQRTLHPTPCGSEQNRKTRTSFATEGGVS
QNSGAPVSDWSSDEEDGNKGRSKSRCTSTLSSHTSEEGVQCSRMGTLMPKHPNSLSGKGT
QLVPSSHLPPPKLRIPNVFSISVALAKRHLSQPQLSSDRMCGTNRNAISMIRPLRPQETD
LDLVDGDSAEVLENMDTSCDDGLFSYDFLDSPNSDDQENCDSAKKAACSKPPTPPLHRFP
SWESRIYAVAKSGIRMSEAFNMENVTICSSFHSALSYTTSGLYTSLIYKNMTTPVYTTLK
GKATQISSSPFLDDSSGSEEEDSSRSSSRTSESDSRSRSGPGSPRAMKRGVSLSSVASES
DYAIPPDAYSTDTEYSQPEQKLPKTCSSSSDNGKNEPLEKSGYLLKMSGKVKSWKRRWFV
LKGGELLYYKSPSDVIRKPQGHIELSASCSILRGDNKQTVQLTTEKHTYYLTADSPNILE
EWIKVLQNVLRVQAANPLSLQPEGKPTVKGLLTKVKHGYSKRVWCTLIGKTLYYFRSQED
KFPLGQIKLWEAKVEEVDRSCDSDEDYEASGRSLLSTHYTIVIHPKDQGPTYLLIGSKHE
KDTWLYHLTVAAGSNNVNVGSEFEQLVCKLLNIDGEPSSQIWRHPTLCHSKEGIISPLTT
LPSEALQTEAIKLFKTCQLFINAAVDSPAIDYHISLAQSALQICLTHPELQNEICCQLIK
QTRRRQPQNQPGPLQGWQLLALCVGLFLPHHPFLWLLRLHLKRNADSRTEFGKYAIYCQR
CVERTQQNGDREARPSRMEILSTLLRNPYHHSLPFSIPVHFMNGIYQVVGFDASTTVEEF
LNTLNQDTGMRKPAQSGFALFTDDPSGRDLEHCLQGNIKICDIISKWEQASKEQQPGKCE
GTRTVRLTYVYRLYFSVQARGETDREKLLLMYQTNDQIINGLFPLNKDLALEMAALLAQN
RSIFSAHIEREASPFPPGTTSCECEFLALKQVIEKFYPKRYRDGCSEEQLRQLCQRLSTR
WMALRGHSAADCVRIYLTVARKWPFFGAKLFLAKPITPSSLGSTFMWLAVNEDGLNLLEY
NSMRLIVSYVYKSLMTFGGYQDDFMVVINNTHSKDTPTEKLLFAMAKPKILEITLLIASY
INNFHQQKAAFHHLSAPALLSAQTRGPQARMMGSQPLLSSSRPTKGPTLL
Download sequence
Identical sequences ENSMMUP00000036575 ENSMMUP00000010579 9544.ENSMMUP00000036575

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]