SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000010626 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000010626
Domain Number 1 Region: 309-492
Classification Level Classification E-value
Superfamily NTF2-like 6.92e-65
Family NTF2-like 0.000000891
Further Details:      
 
Domain Number 2 Region: 45-139
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.67e-36
Family Non-canonical RBD domain 0.0000538
Further Details:      
 
Domain Number 3 Region: 143-297
Classification Level Classification E-value
Superfamily L domain-like 2.04e-32
Family mRNA export factor tap 0.00000325
Further Details:      
 
Domain Number 4 Region: 490-556
Classification Level Classification E-value
Superfamily UBA-like 1.15e-24
Family TAP-C domain-like 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000010626   Gene: ENSMMUG00000032391   Transcript: ENSMMUT00000011338
Sequence length 560
Comment pep:known chromosome:MMUL_1:X:100849832:100866901:1 gene:ENSMMUG00000032391 transcript:ENSMMUT00000011338 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRDVHKDQQLRHTPYSIRCDRRMKWHSEDEICITTWRNRKPPGRKMRQNTQDGYTRNWFK
VTIPYGIKYDKSWLMNSIQSHCSAPFTPVDFHYIRNRACFFVQDATTASVLKDVSYKICD
DENRKICIFVNHSTAPYSVKNKLKPGQMEMLKLTMNKRYNVSQQALDLQNLRFDPDLMGR
DIDIILNRRNCMAATLKIIERNFPELLSLNLCNNKLYQLDGLSDIIEKAPKVKTLNLSKN
KLESAWELGKVKGLKLEELWLEGNPLCSTFSDQSAYVSAIRDCFPKLLRLDGRELSAPMI
VDIDSSEIMKPCKENFTGSETLKHLVLQFLQQYYSIYDSGDRQGLLGAYHDEACFSLAIP
FDAEDSAPNSLRKYFEDSRNMKTLKDPHLKGELLRHTKRDIVDSLSALPKTQHDLSSILV
DMWCQTEWMLCFSVNGVFKEVEGQSQGSVLAFTRTFIATPGGSSSLCIVNDELFVRDASP
QETQSAFSIPVSTLSSSSEPSLSQEQQEMVQAFSAQSGMKLEWSQKCLQDNEWNYTRAGQ
VFTMLQTEGKIPAEAFKQIS
Download sequence
Identical sequences ENSMMUP00000010626 9544.ENSMMUP00000010626 ENSMMUP00000010626

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]