SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000010631 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000010631
Domain Number 1 Region: 1224-1409
Classification Level Classification E-value
Superfamily gamma-Crystallin-like 1.34e-49
Family Crystallins/Ca-binding development proteins 0.0000638
Further Details:      
 
Domain Number 2 Region: 1422-1589
Classification Level Classification E-value
Superfamily gamma-Crystallin-like 7.98e-49
Family Crystallins/Ca-binding development proteins 0.00019
Further Details:      
 
Domain Number 3 Region: 1027-1211
Classification Level Classification E-value
Superfamily gamma-Crystallin-like 6.39e-48
Family Crystallins/Ca-binding development proteins 0.001
Further Details:      
 
Domain Number 4 Region: 1590-1722
Classification Level Classification E-value
Superfamily Ricin B-like lectins 1.62e-19
Family Ricin B-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000010631   Gene: ENSMMUG00000008120   Transcript: ENSMMUT00000011344
Sequence length 1727
Comment pep:known chromosome:MMUL_1:4:102404023:102617976:1 gene:ENSMMUG00000008120 transcript:ENSMMUT00000011344 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEKKSSGRRSGRRRRSQKSTDSPGADAELPESAARDDAVFDDEVAPNAASDCSSAEKKVK
SPRAALDGGVASAASPESKPGPGPKGQLRGESDRSKQPPPASSPTKRKGRSRALEAVPAP
PASGPRAPAKESPPKRVPDPGPVTKGAAAESGEEAARAVPRELPVKSSSLLPEIKPEHKR
GPLPNHFDGRAEGGRSKELGRAAGAPGASDADGLKPRNHFGVGRSTVTTKVTLPAKPKHV
ELNLKTPKNLDSLGNEHNPFSQPVHKGNTATKISLFENKRANSSPRHTDIRGTRNTPASS
KTFVGRAKLNLAKKAKEMEQPEKKVMPNSPQSGVLVKETAVETKVTLSEEEILPATGGMN
GDPSENQALGPQPNQDDKADVQIDAGCPSEPVASALIPVKDHKLLEKDSEAADSKRLVLE
NVTNAAQDIPITVDTKDLPPAAMPKPQHTSSDSQAPTESSPEPSLSLSAPTPGDVAKDTC
VQSPISSFPCTDLRVSENHKGRVLPVSHQNNEKMPLSELGGETNPPLSTEHSPEAVGSEC
PSRVLVQVRSFVLPVESTQDVSSQVIPESSEVREVQLPTCHSNEPEVVSVASCAPLQEEV
LGNKSMSPEHSHCTAELAAKSGPQVVPPASEKTLPIQAQSQGNRTPLMTESSPTNSPSSG
NHLDTPQKPDQTVRHGWHSPAGFLNISAGSDDSVFDSSSDMEKFTEIIKQMDSAVCMPMK
RKKARMPNSPAPHFAMPPIHEDHLEKVFDPNVFTFGLGKKKESQPEMSPALHLMQSLDTK
SQLRPKRASAEQSVLFKSLHTNTNGNSEPLVMPEINDKENRDITSGSIKRSRLEKSALFS
SLLSSLPQDKIFSPSVTSVNTMTTAFSTSQNGSLSQSSVSQPTTEGAPPCGLNKEQPNLP
DNSLKVFSFNSSSTSHSSLKSPSHMEKYPQKEKTKEDKEDLDSRSNLHLLETKFSEFSKL
KNDDMEKANHTENVLKSNLPNCGNSDTDFMGLFKSSRYDPGISFSGMSLSDTMTLRGSVQ
NKLNPRPGKVVIYSEPDVSEKCIEVFSDIQDCSSWSLSPVILIKVVRGCWILYEQPNFEG
HSIPLEEGELELSGLWGVEDILESHEEAESDKPVVIGSIRHVVQDYRVSHIDLFTEPEGL
GILSSYFDDTEEMQGFGVMQKTCSMKVHWGTWLIYEEPGFQGVPFILEPGEYPDLSFWDT
EAAYIGSMRPLKMGGRKVEFPTDPKVVVYEKPFFEGKCVELETEMCSFVMEGGETEEATG
GDHLPFTSVGSVKVLRGIWVAYEKPGFTGHQYLLEEGEYRDWKAWGGYNGELQSLRPILG
DFSNAHMIMYSEKNFGSKGSSIDVLGIVANLKETGYGVKTQSINVLSGVWVAYENPDFTG
EQYILDKGFYSSFEDWGGKNCKISSVQPICLDSFTGPRRRNQIHLFSEPQFQGHSQSFEE
TTSQIDDSFSTKSCRVSGGSWVVYDGENFTGNQYVLEEGHYPCLSAMGCPPGATFKSLRF
IDVEFSEPTIILFEREDFKGKKIELNAETINLRSLGFNTQIRSVQVIGGIWVTYEYGNYR
GRQFLLSPAEVPNWYEFSGCRQIGSLRPFVQKRIYFRLRNKATGLFMSTNGNLEDLKLLR
IQVMEDVGADDQIWIYQEGCIKCRIAEDCCLTIVGSLVTSGSKLGLALDQNADSQFWSLK
SDGRIYSKLKPNLVLDVKGGTQYDQNHIILNTVSKEKFTQVWEAMVL
Download sequence
Identical sequences ENSMMUP00000010631 XP_014992494.1.72884 9544.ENSMMUP00000010631 ENSMMUP00000010631

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]