SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000010657 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000010657
Domain Number 1 Region: 72-443
Classification Level Classification E-value
Superfamily SAICAR synthase-like 5.01e-124
Family Phosphatidylinositol phosphate kinase IIbeta, PIPK IIbeta 0.00000651
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000010657   Gene: ENSMMUG00000008137   Transcript: ENSMMUT00000011371
Sequence length 669
Comment pep:known chromosome:MMUL_1:19:3471346:3536362:-1 gene:ENSMMUG00000008137 transcript:ENSMMUT00000011371 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELEVPDEAESAEAGAVPSEAAWAAESGAAAGLAQKKAAPTEALSMTAQPGPGHGKKLGH
RGVDASGETTYKKTTSSTLKGAIQLGIGYTVGHLSSKPERDVLMQDFYVVESIFFPSEGS
NLTPAHHFQDFRFKTYAPVAFRYFRELFGIRPDDYLYSLCNEPLIELSNPGASGSLFYVT
SDDEFIIKTVMHKEAEFLQKLLPGYYMNLNQNPRTLLPKFYGLYCVQSGGKNIRVVVMNN
ILPRVVKMHLKFDLKGSTYKRRASKKEKEKSFPTYKDLDFMQDMPEGLLLDADTFSALVK
TLQRDCLVLESFKIMDYSLLLGVHNIDQHERERQAQGARGTSDEKRPVGQKALYSTAMES
IQGGAARGEPIESDDTMGGIPAVNGRGERLLLHIGIIDILQSYRFIKKLEHTWKALVHDG
DTVSVHRPSFYAERFFKFMSNTVFRKNSSLKSSPSKKGRGGALLAVKPLGPTAAFSASQI
PSEREEAQYDLRGARSYPTLEDEGRPDLLPCTPPSFEEATTASIATTLSSTSLSIPERSP
SETSEQPRYRRRTQSSGQDGSLRENPLGSRSVAQAGVHVWPVISWSLCVGAEGQDPLVEA
SMAGATAAVEAETASQASDEEGAPASQASDEEDTPATDIYFPTDERSWVYSPLHYSAQAP
PASDGESDT
Download sequence
Identical sequences 9544.ENSMMUP00000010657 ENSMMUP00000010657 ENSMMUP00000010657

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]