SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000010693 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000010693
Domain Number 1 Region: 165-437
Classification Level Classification E-value
Superfamily SAICAR synthase-like 2.09e-93
Family Inositol polyphosphate kinase (IPK) 0.0000000000646
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000010693   Gene: ENSMMUG00000008169   Transcript: ENSMMUT00000011409
Sequence length 439
Comment pep:known chromosome:MMUL_1:7:19883791:19893291:1 gene:ENSMMUG00000008169 transcript:ENSMMUT00000011409 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XERAPRRSVGELRLLFEARCAAVAAAAAAGEPRARGAKRRGGQVPNGLPRAPPARVIPQL
TVTAEEPDVPPTSPGPPERERDCLPAAGSSHLQQPRRLSTSSVSSTGSSSLLEDSEDDLL
SDSESRSRGNVQLEAGEDVGQKSHWQKIRTMVNLPVISPFKKRYAWVQLAGHTGSFKAAG
TSGLILKRCSEPERYCLARLMADALRGCVPAFHGVVEHDGESYLQLQDLLDGFDGPCVLD
CKMSVRTYLEEELTKARERPKLRKDMYKKMLAVDPEAPTEEEHAQRAVTKPRYMQWREGI
SSSTTLGFRIEGIKKADGSCSTDFKTTRSREQVLRVFEEFVQGDEEVLRRYLNRLQQIRD
TLEVSEFFRRHEVIGSSLLFVHDHCHRAGVWLIDFGKTTPLPDGQILDHRRPWEEGNRED
GYLLGLDNLIGILASLAER
Download sequence
Identical sequences ENSMMUP00000010693 9544.ENSMMUP00000010693 ENSMMUP00000010693

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]