SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000010720 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000010720
Domain Number 1 Region: 28-236,297-354
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 5.89e-28
Family D-aminoacid oxidase, N-terminal domain 0.001
Further Details:      
 
Domain Number 2 Region: 223-309
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 8.76e-22
Family D-aminoacid oxidase-like 0.0005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000010720   Gene: ENSMMUG00000008185   Transcript: ENSMMUT00000011438
Sequence length 368
Comment pep:known chromosome:MMUL_1:4:153548246:153571349:1 gene:ENSMMUG00000008185 transcript:ENSMMUT00000011438 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RPARHCKTSFGARDFGGFQDCFFRDRPMDTARIAVVGAGVVGLSTAVCISKLVPQCSVTI
ISDKFTPDTTSDVAAGMLIPHTYPDTPIHTQKQWFRETFNHLFAIANSAEAGDAGVHLVS
GWQIFQSTPTEELPFWADVVLGFRRMTEAELKKFPQYVFGQAFTTLKCECPAYLPWLEKR
IKGSGGWMLTRRIDDLWELYPSFDIVVNCSGLGSRQLAGDANIFPVRGQVLQVQAPWVEH
FIRDGSGLTYIYPGTSHVTLGGTRQKGDWNLSPDAENSREILSRCCALEPSLHGACNIRE
KVGLRPYRPGVRLQTELLARDGRRLPVVHHYGHGSGGISVHWGTALEAARLVSECVHALR
TPIPKSKL
Download sequence
Identical sequences G8F2J0
ENSMMUP00000010720 9544.ENSMMUP00000010720 ENSMMUP00000010720

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]