SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000010801 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000010801
Domain Number 1 Region: 615-914
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.15e-84
Family Protein kinases, catalytic subunit 0.00000000103
Further Details:      
 
Domain Number 2 Region: 29-201
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 4.68e-73
Family Ephrin receptor ligand binding domain 0.000000941
Further Details:      
 
Domain Number 3 Region: 325-530
Classification Level Classification E-value
Superfamily Fibronectin type III 6.34e-40
Family Fibronectin type III 0.0000742
Further Details:      
 
Domain Number 4 Region: 909-979
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.0000000000497
Family SAM (sterile alpha motif) domain 0.0016
Further Details:      
 
Domain Number 5 Region: 253-317,363-379
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000105
Family Growth factor receptor domain 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000010801   Gene: ENSMMUG00000008242   Transcript: ENSMMUT00000011521
Sequence length 984
Comment pep:known chromosome:MMUL_1:2:13335745:13692156:1 gene:ENSMMUG00000008242 transcript:ENSMMUT00000011521 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDCHLSILLLLSCSFLNCFGELIPQPSNEVNLLDSKTIQGELGWISYPSHGWEEISGVDE
HYTPIRTYQVCNVMDHSQNNWLRTNWVPRNSAQKIYVELKFTLRDCNSIPLVLGTCKETF
NLYYMESDDDHGVKFREHQFTKIDTIAADESFTQMDLGDRILKLNTEIREVGPVNKKGFY
LAFQDVGACVALVSVRVYFKKCPFTVKNLAMFPDTVPMDSQSLVEVRGSCVNNSKEEDPP
RMYCSTEGEWLVPIGKCSCNAGYEERGFMCQACRPGFYKALDGNMKCAKCPPHSSTQEDG
SMNCRCENNYFRADKDPPSMACTRPPSSPRNVISNINETSVILDWSWPLDTGGRKDVTFN
IICKKCGWNIKQCEPCSPNVRFLPRQFGLTNTTVTVTDLLAHTNYTFEIDAINGVSELSS
PLRQFAAVSITTNQAAPSPVLTIKKDRTSRNSISLSWQEPEHPNGIILDYEVKYYEKQEQ
ETSYTILRARGTNVTISSLKPDTTYVFQIRARTAAGYGTNSRKFEFETSPDSFSISGESS
QVVMIAISAAVAIILLTVVIYVLIGRFCGYNKSKHGADEKRLHFGNGHLKLPGLRTYVDP
HTYEDPTQAVHEFAKELDATNISIDKVVGAGEFGEVCSGRLKLPSKKEISVAIKTLKVGY
TEKQRRDFLGEASIMGQFDHPNIIRLEGVVTKSKPVMIVTEYMENGSLDSFLRKHDAQFT
VIQLVGMLRGIASGMKYLSDMGYVHRDLAARNILINSNLVCKVSDFGLSRVLEDDPEAAY
TTRGGKIPIRWTSPEAIAYRKFTSASDVWSYGIVLWEVMSYGERPYWEMSNQDVIKAVDE
GYRLPPPMDCPAALYQLMLDCWQKDRNNRPKFEQIVSILDKLIRNPGSLKIITSAAARPS
NLLLDQSNVDITTFRTTGDWLNGVRTAHCKEIFTGVEYSSCDTIAKISTDDMKKVGVTVV
GPQKKVISSITALETQSKNSPVPV
Download sequence
Identical sequences A0A2K5UU29 A0A2K6CN86 F7HDY6
ENSMMUP00000010801 XP_001083136.1.72884 XP_005548443.1.63531 XP_011732193.1.29376 9544.ENSMMUP00000010801 ENSMMUP00000010801

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]