SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000010805 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000010805
Domain Number 1 Region: 47-128
Classification Level Classification E-value
Superfamily FKBP-like 1.64e-19
Family FKBP immunophilin/proline isomerase 0.00000511
Further Details:      
 
Domain Number 2 Region: 2-39
Classification Level Classification E-value
Superfamily WW domain 0.000000000000556
Family WW domain 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000010805   Gene: ENSMMUG00000008245   Transcript: ENSMMUT00000011525
Sequence length 128
Comment pep:known chromosome:MMUL_1:19:9632230:9645333:1 gene:ENSMMUG00000008245 transcript:ENSMMUT00000011525 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADEEKLPPGWEKRMSRSSGRVYYFNHITNASQWERPSGNSSSGGKNGQGEPARVRCSHL
LVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARG
DLGAFSRG
Download sequence
Identical sequences ENSMMUP00000010805 ENSMMUP00000010805 9544.ENSMMUP00000010805

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]