SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000010811 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000010811
Domain Number 1 Region: 160-235
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 6.43e-20
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000311
Further Details:      
 
Domain Number 2 Region: 67-147
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 2.78e-19
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000367
Further Details:      
 
Domain Number 3 Region: 351-426
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 4.68e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000612
Further Details:      
 
Domain Number 4 Region: 256-345
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000000142
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000433
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000010811   Gene: ENSMMUG00000008249   Transcript: ENSMMUT00000011532
Sequence length 572
Comment pep:known chromosome:MMUL_1:15:8185868:8211645:-1 gene:ENSMMUG00000008249 transcript:ENSMMUT00000011532 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAELVQGQSAPVGMKAEGIVDALHRVRQIAAKIDSIPHLNNSTPLVDPSVYGYGVQKRPL
DDGVGNQLGALVHQRTVITEEFKVPDKMVGFIIGRGGEQISRIQAESGCKIQIASESSGI
PERPCVLTGTPESIEQAKRLLGQIVDRCRNGPGFHNDIDSNSTIQEILIPASKVGLVIGR
GGETIKQLQERTGVKMVMIQDGPLPTGADKPLRITGDAFKVQQAREMVLEIIREKDQADF
RGVRGDFSSRVGGGSIEVSVPRFAVGIVIGRNGEMIKKIQNDAGVRIQFKPDDGISPERA
AQVMGPPDRCQHAAHIISELILTAQERDGFGGLAAARGRGRGRGDWSVGAPGGVQEITYT
VPADKCGLVIGKGGENIKSINQQSGAHVELQRNPPPNSDPNLRRFTIRGVPQQIEVARQL
IDEKVGGTNLGAPGAFGQSPFSQPPAPPHQNTFPPRSSGCFPNMAAKVNGNPHSTPVSGP
PAFLTQGWGSTYQAWQQPTQQVPSQQSQPQSSQPSYSKAWEDYYKKQSHAASAAPQASSP
PDYTMAWAEYYRQQVAFYGQTLGQAQAHSQVC
Download sequence
Identical sequences 9544.ENSMMUP00000040007 ENSMMUP00000040007 ENSMMUP00000010811

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]