SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000010848 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000010848
Domain Number 1 Region: 420-499
Classification Level Classification E-value
Superfamily Homeodomain-like 9.86e-24
Family SWIRM domain 0.00025
Further Details:      
 
Domain Number 2 Region: 137-192,232-267
Classification Level Classification E-value
Superfamily BRCT domain 0.00000000000224
Family DNA topoisomerase II binding protein 1, TopBP1 0.082
Further Details:      
 
Domain Number 3 Region: 629-680
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000000336
Family Homeodomain 0.07
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000010848
Domain Number - Region: 196-234
Classification Level Classification E-value
Superfamily Chromo domain-like 0.0115
Family Chromo domain 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000010848   Gene: ENSMMUG00000008273   Transcript: ENSMMUT00000011570
Sequence length 951
Comment pep:known chromosome:MMUL_1:11:53226610:53248297:-1 gene:ENSMMUG00000008273 transcript:ENSMMUT00000011570 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVRKKDGGPNVKYYEAADTVTQFDNVRLWLGKNYKKYIQAEPPTNKSLSSLVVQLLQFQ
EEVFGKHVSNAPLTKLPIKCFLDFKAGGSLCHILAAAYKFKSDQGWRRYDFQNPSRMDRN
VEMFMTIEKSLVQNNCLSRPNIFLCPEIEPKLLGKLKDIIKRHQGTVTEDKNNASHVVYP
VPGNLEEEEWVRPVMKRDKQVLLHWGYYPDSYDTWIPASEIEASVEDAPTPEKPRKIHAK
WILDTDTFNEWMNEEDYEVNDDKNPVSRRKKISAKTLTDEVNSPDSDRRDKKGGNYKKRK
RSPSPSPTPEAKKKNAKKGPSTPYTKSKRGHREEEQEDLTKDMDEPSPVPNVEEVTLPKT
VNTKKDSESAPVKGGTMTDLDEQEDESMETTGKDEDENSTGNKGEQTKNPDLHEDNVTEQ
THHIIIPSYAAWFDYNSVHAIERRALPEFFNGKNKSKTPEIYLAYRNFMIDTYRLNPQEY
LTSTACRRNLAGDVCAIMRGYMKMPAYGCVLTTVDAESRPTPMGPPPTSHFHVLADTPSG
LVPLQPKTPQGRQVDADTKAGRKGKELDDLVPETAKGKPELQTSASQQMLNFPDKGKEKP
TDMQNFGLRTDMYTKKNVPSKSKAAASATREWTEQETLLLLEALEMYKDDWNKVSEHVGS
RTQDECILHFLRLPIEDPYLEDSEASLGPLAYQPIPFSQSGNPVMSTVAFLASVVDPRVA
SAAAKSALEEFSKMKEEVPTALVEAHVRKVEEAAKVTGKADPAFGLESSGIAGTTSDEPE
RIEESGNDEARVEGQATDEKKEPKEPREGGGAIEEEAKEKTSEAPKKDEEKGKEGDSEKE
SEKSDGDPIVDPEKEKEPKEGQEEVLKEVVESEGERKTKVERDIGEGNLSTAAAAALAAA
AVKAKHLAAVEERKIKSLVALLVETQMKKLEIKLRHFEELETIMDREREAV
Download sequence
Identical sequences ENSMMUP00000010848 ENSMMUP00000010848 9544.ENSMMUP00000010848

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]