SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000010851 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000010851
Domain Number 1 Region: 290-443
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.71e-52
Family SPRY domain 0.0000178
Further Details:      
 
Domain Number 2 Region: 31-140
Classification Level Classification E-value
Superfamily Immunoglobulin 2.23e-17
Family V set domains (antibody variable domain-like) 0.00041
Further Details:      
 
Domain Number 3 Region: 154-229
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000207
Family C1 set domains (antibody constant domain-like) 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000010851   Gene: ENSMMUG00000008275   Transcript: ENSMMUT00000011574
Sequence length 521
Comment pep:known chromosome:MMUL_1:9:17538632:17540427:1 gene:ENSMMUG00000008275 transcript:ENSMMUT00000011574 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDTAAAPHFSLPGSLLLLLLSLCALVSAQLTVVGPASPILAMVGENTTLHCHLSPEKNAE
DMRWFRSQFSAAVFVYKGGRERTEEQMEEYRGRITFVNKGISRGSVALVVHNVTAQENDI
YRCHFQEGWSYDKAILRLVVAGLGSKPLIEIKAQEDGSIWLQCISGGWYPEPLTAWRDLY
SEIVPTLKEVSIADADGFFVVTTAVIIRDKSVRNVFCSIENTLLSQEKETVVFIPESFMP
STSPCFMAVSICCIKKLQREKKILSGEKEVEQEEKEIAQQLQEELRWRTFLHAADVVLDP
DTTHPELFLSEDQRSVRQGPYRQVPDNPERFDSQPCVLGWESFASGKHDWEVEVENVMVW
TVGVCGDGVERKGEVLLIPQNGFWTLEVFGNQYWALSSPDRILPLKESLCWVPIFLDYEA
GDVSFYNMRDRSHIYTCPRSAFSVPPDTSQSGDPAEPVESIPWTHSHADKPWPSQQPLHN
TPNGRHALLPSAHMREHLPAAFFTPTPALSPSFLLLTRPWL
Download sequence
Identical sequences ENSMMUP00000010851 ENSMMUP00000010851 9544.ENSMMUP00000010851

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]