SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000010973 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000010973
Domain Number 1 Region: 231-363
Classification Level Classification E-value
Superfamily Cadherin-like 9.95e-34
Family Cadherin 0.0011
Further Details:      
 
Domain Number 2 Region: 439-568
Classification Level Classification E-value
Superfamily Cadherin-like 2.75e-28
Family Cadherin 0.0013
Further Details:      
 
Domain Number 3 Region: 128-235
Classification Level Classification E-value
Superfamily Cadherin-like 9.16e-24
Family Cadherin 0.0067
Further Details:      
 
Domain Number 4 Region: 341-444
Classification Level Classification E-value
Superfamily Cadherin-like 6.67e-23
Family Cadherin 0.0048
Further Details:      
 
Domain Number 5 Region: 555-664
Classification Level Classification E-value
Superfamily Cadherin-like 1.36e-17
Family Cadherin 0.0031
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000010973
Domain Number - Region: 32-98
Classification Level Classification E-value
Superfamily Cadherin-like 0.000106
Family Cadherin 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000010973   Gene: ENSMMUG00000008368   Transcript: ENSMMUT00000011701
Sequence length 798
Comment pep:known chromosome:MMUL_1:6:137608487:137610883:1 gene:ENSMMUG00000008368 transcript:ENSMMUT00000011701 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEASGKLICRQRQVLFHFLLLGFSLAGAAEPRRYSVVEETEGSSFVTNLAKDLGLEQREF
SRRGVRVVSRGNKLHLQLNQKTGDLLLNEKLDREDLCGHTEPCVLHFQVLLESPFEFFQA
ELQVIDINDHSPVFLDKEMLVKVSESSPPGTTFPLKNAEDLDVGQNNIENYIISPNSYFR
VLTRKRSDGRKYPELVLDKALDREAEAELRLTLTALDGGSPPRSGTAQVYIEVLDVNDNA
PEFEQPFYRVQISEDSPIGFLVVKVSATDVDTGVNGEISYSLFQASDEISKTFKVDSLTG
EIELKKQLDFEKLQSYEVNIEARDAGTFSGKCTVLIQVMDVNDHAPEVTMSAFTSPIPEN
APETVVALFSVSDLDSGENGEISCSIQEDLPFLLKSAENFYTLLTERPLDRESRGEYNIT
ITVTDLGTPMLKTQLNITVLVADVNDNAPAFTQTSYTLFVRENNSPALHIGSVSATDRDS
GTNAQVTYSLLPPQDAHLSLTSLVSINADNGHLFALRSLDYEALQGFEFRVGASDRGSPA
LSSEALVRVLVLDANDNSPFVLYPPQNGSAPCIELVPRAAEPGYLVTKVVAVDGDSGQNA
WLSYQLLKATELGLFGVRAHNGEVRTARLLSERDAAKHRLVVLVKDNGEPPRSATATLHV
LLVDGFSQPYLPLPGATPAQAQADSLTIYLVVALASVSSLFLLSVLLFVAVRLCRRSMAA
SVGRCSVPKGPFRGHLVDVSGTGTLSQSYQYEVCLAGGSGTNEFKFLKPIIPDFPPQCPG
KEIQGNATFSNDFGFNIQ
Download sequence
Identical sequences ENSMMUP00000010973 9544.ENSMMUP00000025646 ENSMMUP00000025646

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]