SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000010986 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000010986
Domain Number 1 Region: 7-89
Classification Level Classification E-value
Superfamily Cytochrome b5-like heme/steroid binding domain 4.19e-20
Family Cytochrome b5 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000010986   Gene: ENSMMUG00000008381   Transcript: ENSMMUT00000011715
Sequence length 372
Comment pep:known chromosome:MMUL_1:20:72817573:72880106:-1 gene:ENSMMUG00000008381 transcript:ENSMMUT00000011715 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPAPPPAASFSPSEVQRRLAAGACWVRRGARLYDLSSFVRHHPGGEQLLRARAGQDISA
DLDGPPHRHSANARRWLEQYYVGELRGEQQGSMENEAVALEETQKTDPAMEPRFKVVDWD
KDLVDWQKPLLWQVGHLGEKYDEWVHQPVTRPIRLFHSDLIEGLSKTVWYSVPIIWVPLV
LYLSWSYYRTFAQGNVRLFTSFTTEYALAVPKSMFPGLFMLGIFLWSLIEYLIHRFLFHM
KPPSDSYYLIMLHFVMHGQHHKAPFDGSRLVFPPVPASLVIGVFYLCLQLILPEAVGGTV
FAGGLLGYVLYDMTHYYLHFGSPHRGSYLYNLKAHHVKHHFAHQKSGFGISTKLWDYCFH
TLIPEKPHLKTQ
Download sequence
Identical sequences A0A2K5MM77 F7HMN1 Q4R4P4
ENSMMUP00000010986 NP_001181351.1.72884 NP_001270612.1.63531 XP_011889837.1.92194 9544.ENSMMUP00000010986 ENSMMUP00000010986

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]