SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000011001 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000011001
Domain Number 1 Region: 40-508
Classification Level Classification E-value
Superfamily DPP6 N-terminal domain-like 3.01e-78
Family DPP6 N-terminal domain-like 0.0000000000000191
Further Details:      
 
Domain Number 2 Region: 511-763
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 6.26e-70
Family DPP6 catalytic domain-like 0.000000000652
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000011001   Gene: ENSMMUG00000008387   Transcript: ENSMMUT00000011731
Sequence length 766
Comment pep:known chromosome:MMUL_1:12:25560258:25645361:-1 gene:ENSMMUG00000008387 transcript:ENSMMUT00000011731 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKTAWKVLLGLLGAAALVTIITVPVVLLNKGTDDATADSRKTYTLTDYLKNTYRLKLYSL
RWISDHEYLYKQENNILVFNAEYGNSSVFLENSTFDEFGHSINDYSISPDGQFILLEYNY
VKQWRHSYTASYDIYDLNKRQLITEERIPNNTQWVTWSPVGHKLAYVWNNDIYVKIEPNL
PSHRITSTGKEDMIYNGITDWVYEEEVFSAYSALWWSPNGTFLAYAQFNDTEVPLIEYSF
YSDESLQYPKTVQVPYPKAGAVNPTVKFFVVNTDSLSSATNATSIQITAPASMLIGDHYL
CDVTWATQERISLQWLRRIQNYSVMDICDYDESSGRWNCLVARQHIETSTTGWVGRFRPS
EPHFTSDGNSFYKIISNEEGYRHICYFQINKKNCTFITKGAWEVIGIEALTSDYLYYISN
EYKGMPGGRNLYKIQLSDYTKVTCLSCELNPERCQYYSVSFSKEAKYYQLRCSGPGLPLY
TLHSSVNDKGPRVLEDNSALDKMLQNVQMPSKTLDFIILNETKFWYQMILPPHFDKSKKY
PLLLDVYAGPCSQKADAVFRLNWATYLASTENIIVASFDGRGSGYQGDKIMHAINRRLGT
FEVEDQIEAARQFSKMGFVDNKRIAIWGWSYGGYVTSMVLGSGSGVFKCGIAVAPVSRWE
YYDSVYTERYMGLPTPEDNLDHYRNSTVMSRAENFKQVEYLLIHGTADDNVHFQQSAQIS
KALVDAGVDFQAMWYTDEDHGIASSTAHQHIYTHMSHFIKQCFSLP
Download sequence
Identical sequences A0A096MY81 A0A2K5VXG8 A0A2K6CQY0 F6VRB0
ENSMMUP00000011001 9544.ENSMMUP00000011001 NP_001034279.2.72884 XP_005573374.1.63531 XP_011742481.1.29376 ENSMMUP00000011001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]