SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000011068 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000011068
Domain Number 1 Region: 33-318
Classification Level Classification E-value
Superfamily L domain-like 1.81e-47
Family Ngr ectodomain-like 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000011068   Gene: ENSMMUG00000008443   Transcript: ENSMMUT00000011802
Sequence length 353
Comment pep:known chromosome:MMUL_1:14:74964904:74965965:1 gene:ENSMMUG00000008443 transcript:ENSMMUT00000011802 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPWPLLLLLAVSGAQTTRPCFPGCQCEVETFGLFDSFSLTRVDCSGLGPHIMPVPIPLDT
AHLDLSSNQLEMVNESVLAGPGYTTLAGLDLSHNLLTSISPTAFSRLRYLESLDLSHNGL
TALPAESFTSSPLSDVNLSHNQLREVSVSAFTTHSQGRALHVDLSHNLIHRLVPHPARAG
LPAPAIQSLNLAWNRLHAVPNLQDLPLRYLSLDGNPLAVIGPGAFAGLAGLTHLSLASLQ
RLPELAPYGFRELPGLQVLDLSGNPKLNWAGAEVFSGLNSLQELDLSGTNLVPLPEALLL
HLPALQSVSVGQDVWCRRLVREGAYPRRPGSSPKVALHCVDTRESAARGPNIL
Download sequence
Identical sequences A0A2K5KYP7 A0A2K5UJ20 A0A2K6AUJ8 F6V3X4
XP_005579205.1.63531 XP_005579206.1.63531 XP_011717448.1.29376 XP_011717450.1.29376 XP_011717451.1.29376 XP_011717452.1.29376 XP_011900155.1.92194 XP_014970726.1.72884 XP_014970727.1.72884 XP_015291000.1.63531 XP_015291001.1.63531 9544.ENSMMUP00000011068 ENSMMUP00000011068 ENSMMUP00000011068

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]