SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000011122 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000011122
Domain Number 1 Region: 44-290
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 1.02e-52
Family Haloperoxidase 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000011122   Gene: ENSMMUG00000008483   Transcript: ENSMMUT00000011860
Sequence length 291
Comment pep:known chromosome:MMUL_1:4:2967867:3000292:1 gene:ENSMMUG00000008483 transcript:ENSMMUT00000011860 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVAVLGGRGVLRLRLLLSALKPGIHVPRAGPAAAFGTSVTSAKVAVNGVQLHYQQTGEGG
HAVLLLPGMLGSGETDFGPQLKNLNKKLFTVVAWDPRGYGHSRPPDRDFPADFFERDAKD
AVDLMKALKFKKVSLLGWSDGGITALIAAAKYPSYIHKMVIWGANAYVTDEDSMIYEGIR
DVSKWSERTRKPLEALYGYDYFARTCEKWVDGIRQFKHLPDGNICRHLLPQVQCPTLIVH
GEKDPLVPRFHANFIHEHVKGSRLHLMPEGKHNLHLRFANEFNRLAEGFLQ
Download sequence
Identical sequences A0A2K5WW09 A0A2K6CGA5 F6THE6
9544.ENSMMUP00000011122 XP_005554213.1.63531 XP_011749074.1.29376 XP_014990926.1.72884 ENSMMUP00000011122 ENSMMUP00000011122

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]