SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000011141 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000011141
Domain Number 1 Region: 164-386
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 5.61e-52
Family FAD-linked oxidases, N-terminal domain 0.013
Further Details:      
 
Domain Number 2 Region: 390-439,467-653
Classification Level Classification E-value
Superfamily FAD-linked oxidases, C-terminal domain 3.27e-34
Family Vanillyl-alcohol oxidase-like 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000011141   Gene: ENSMMUG00000008502   Transcript: ENSMMUT00000011881
Sequence length 659
Comment pep:known chromosome:MMUL_1:12:41001113:41155991:1 gene:ENSMMUG00000008502 transcript:ENSMMUT00000011881 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEAVAAAGGTGSGAGAGASASYGSAVDRDRDPDRPGRRLRVLSGHLLGRPREALSTNEC
KARRAASAATAAPTATPAAQESGTIPKKRQEVMKWNGWGYNDSKFIFNKKGQIELTGKRP
GLFLLFLTLNVFLKSLHFVIILSKYPKFASLNPSDTPPSVVNEDFLHDLKETNISYSQEA
DDRVFRAHGHCLHEIFLLREGMFERIPDIVLWPTCHDDVVKIVNLACKYNLCIIPIGGGT
SVSYGLMCPADETRTIISLDTSQMNRILWVDENNLTAHVEAGITGQELERQLKESGYCTG
HEPDSLEFSTVGGWVSTRASGMKKNIYGNIEDLVVHIKMVTPRGIIEKSCQGPRMSTGPD
IHHFIMGSEGTLGVITEATIKIRPVPEYQKYGSVAFPNFEQGVACLREIAKQRCAPASIR
LMDNKQFQFGHALKPQVSSIFTSFLDGLKKFYITKFKGFDPNQLSVATLLFEGDREKVLQ
HEKQVYDIAAKFGGLAAGEDNGQRGYLLTYVIAYIRDLALEYYVLGESFETSAPWDRVVD
LCRNVKERITRECKEKGVQFAPFSTCRVTQTYDAGACIYFYFAFNYRGISDPLTVFEQTE
AAAREEILANGGSLSHHHGVGKLRKQWLKESISDVGFGMLKSVKEYVDPNNIFGNRNLL
Download sequence
Identical sequences ENSMMUP00000011141 ENSMMUP00000011141 9544.ENSMMUP00000011141

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]