SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000011214 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000011214
Domain Number 1 Region: 596-802
Classification Level Classification E-value
Superfamily Fibronectin type III 4.84e-31
Family Fibronectin type III 0.00036
Further Details:      
 
Domain Number 2 Region: 805-990
Classification Level Classification E-value
Superfamily Fibronectin type III 1.28e-25
Family Fibronectin type III 0.000023
Further Details:      
 
Domain Number 3 Region: 312-404
Classification Level Classification E-value
Superfamily Immunoglobulin 5.19e-20
Family I set domains 0.00085
Further Details:      
 
Domain Number 4 Region: 417-506
Classification Level Classification E-value
Superfamily Immunoglobulin 7.11e-20
Family I set domains 0.015
Further Details:      
 
Domain Number 5 Region: 225-318
Classification Level Classification E-value
Superfamily Immunoglobulin 1.99e-17
Family I set domains 0.0016
Further Details:      
 
Domain Number 6 Region: 502-603
Classification Level Classification E-value
Superfamily Immunoglobulin 2.1e-17
Family I set domains 0.043
Further Details:      
 
Domain Number 7 Region: 123-207
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000627
Family I set domains 0.00042
Further Details:      
 
Domain Number 8 Region: 26-119
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000171
Family I set domains 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000011214   Gene: ENSMMUG00000008549   Transcript: ENSMMUT00000011955
Sequence length 1029
Comment pep:known chromosome:MMUL_1:2:59601117:59908661:-1 gene:ENSMMUG00000008549 transcript:ENSMMUT00000011955 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLLWKLVILLPLINSCAGDGLLSRPIFTQEPHDVIFPLDLSKSEVILKCAANGYPSPHY
RWKQNGTDIDFTMSYHYRLDGGSLAISSPHTDQDIGMYQCLATNLLGTILSRKAKLQFAY
IEDFETKTRSTVSVREGQGVVLLCGPPPHFGDLSYAWTFNDNPLYVQEDNRRFVSQETGN
LYIAKVEPSDVGNYTCFITNKEAQRSVQGPPTPLVQRTDGVMGEYEPKIEVRFPETIQAA
KDSSVKLECFALGNPVPDISWRRLDGSPLPGKVKYSKSQAILEIPNFQQEDEGFYECIAS
NLRGRNLAKGQLIFYAPPEWEQKIQNTYLSIYDNLLWKCKASGKPNPWYTWLKNGERLNP
EERIQIENGTLIITMLNVSDSGVYQCAAENKYQIIYANAELRVLASAPDFSKSPVKKNSF
VQVGGDIVIECKPNAFPRAAISWKRGTETLRQSKRMFLLEDGSLKIYNVTRSDAGSYTCI
ATNQFGTAKNAGSLIVKERTVITVPPSKMDVTVGESIVLPCQVSHDPSIEVVFVWFFNGD
IIDLKKGMAHFERIGGESVGDLMIRNIQLNHSGKYLCTVQTTLESLSAVADIIVRGPPGP
PEDVKVEEISSTTSQLSWRAGPDNNSPIQIFTIQTQTPFSVGWQAVATVPEILNGKTYNA
TVVGLSPWVEYEFRVVAGNSIGIGEPSKPSELLRTKASVPAVAPVNVNGGGGSRSELVIT
WESIPEELQNGEGFGYIIMFRPVGSTTWTKEKVASVESSRFVYRNESIIPLSPFEVKVGV
YNNEGEGSLSTVTIVYSGEDEPQLAPRGTSVQSFSASEMEVSWNAIAWNRNTGRVLGYEV
LYWTDDSKESMIGKIRVSGNVTTKNITGLKANTIYFASVRAYNTAGTGPSSPPVNVTTKK
SPPSQPPANIAWKLTNSKLCLNWEHVKTMENESEVLGYKILYRQNRQSKTHILETNNTSA
ELLVPFEEDYLIEIRTVSDGGDGSSSEEIRIPKMSSLSSRGIQVLEPSIHFLSIVIVIFY
CFAIQPLIR
Download sequence
Identical sequences A0A2K5U8V1 A0A2K6AXY2 G7MKV4
ENSMMUP00000011214 ENSMMUP00000011214 9544.ENSMMUP00000011214 XP_005547694.1.63531 XP_005547695.1.63531 XP_011735933.1.29376 XP_011735934.1.29376

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]