SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000011234 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000011234
Domain Number 1 Region: 6-183
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.33e-28
Family Laminin G-like module 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000011234   Gene: ENSMMUG00000031973   Transcript: ENSMMUT00000011977
Sequence length 612
Comment pep:known chromosome:MMUL_1:15:21945450:21960503:-1 gene:ENSMMUG00000031973 transcript:ENSMMUT00000011977 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSWTKAGSPAPPGVIPFQSGFIFTQRARLQAPTGSVIPASLGTELALVLSLCSHRVNHAF
LFAVRSQKHKLQLGLQFLPGKTVVHLGSRRSVAFDLDMHDGRWHHLALELRGRTVTLVTA
CGQRRVPVQLPFHRDPALDPGGSFLFGKMNPHAVQFEGALCQFSIYPVTQVAHNYCTHLR
KQCGQADTYQSPLGPLFSQDSGRPFTFQSDLALLGLENLTTATPLGSQPAGRGPKGTVVP
ATPTKPQRTSPTNPHQHIAVRGPAQTPPAKLSASNTLDPVLPASLGSSTRTPRPAASQPS
QKITATKIPKSLPTKPSAPSTSIVPVKSPHPTQKTAAPSFTKSAPPTQKHVPTVPAKVSR
PAEKPIQRNQGMPRPPLPSTQPLPPTTSSSKKPIPTLAQTEAKVTNHASKPASARTSTHK
PPPFTALSSSPAPTPGSTRTTRPPATMVPPTSGTSAPRTAPAVPTPGSAPTGNKKPTGSE
ASKKAGPESSPRKPVPLRPGKAARDVPLSDLTTRPSPRQSQPSQQTTSALVLAPAQFLSS
SPRPTSSGYSFFHLAGSTPFPLLMGPPGPKGDCGLPGPPGLPGLPGIPGARGPRGPPGPY
GNPGLPGPPGAK
Download sequence
Identical sequences ENSMMUP00000011234 ENSMMUP00000011234 9544.ENSMMUP00000011234

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]