SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000011282 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000011282
Domain Number 1 Region: 155-291
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.19e-27
Family Beta-galactosidase LacA, domains 4 and 5 0.043
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000011282
Domain Number - Region: 8-37
Classification Level Classification E-value
Superfamily (Trans)glycosidases 0.0253
Family Glycosyl hydrolases family 35 catalytic domain 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000011282   Gene: ENSMMUG00000008602   Transcript: ENSMMUT00000012028
Sequence length 307
Comment pep:known chromosome:MMUL_1:14:132403102:132408958:1 gene:ENSMMUG00000008602 transcript:ENSMMUT00000012028 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHFHDYKSDVTSYDYDAVLTEAGDYTAKYMKLRDFFGSISGIPLPPPPDLLPKMSYEPIT
PVLYLSLWDALKYMGEPIKSEKPINMENLPVNGGNGQSFGYILYETSITSSGVLSGRVRD
RGQVFVNTVSIGFLDYKTTKIAVPLIQGYTVLRILVENRGRVNYGENIDDQRKGLIGNLY
LNDSPLKKFRIYSLDMKKSFFQRFGLDKWSSLPETPTLPAFFLGSLSISSTPCDTFLKLE
GWEKGVVFINGQNLGRYWNIGPQKTLYLPGPWLSSGINQVIIFEETMAGPALQFTETPHL
GRNQYIK
Download sequence
Identical sequences ENSMMUP00000011282 ENSMMUP00000011282 9544.ENSMMUP00000011282

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]