SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000011288 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000011288
Domain Number 1 Region: 39-305
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 1.36e-63
Family Thioesterases 0.000000000705
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000011288   Gene: ENSMMUG00000018432   Transcript: ENSMMUT00000012034
Sequence length 306
Comment pep:known chromosome:MMUL_1:4:31775945:31784582:1 gene:ENSMMUG00000018432 transcript:ENSMMUT00000012034 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKSCRSMLGVWGQRLPAAWVLLLLPFLPLLLLQSPAPHRASYKPVIVVHGLFDSSYSFRH
LLEYINETHPGTVVTVLDLFDGRESLRPLWEQVQGFREAVVPIMAKAPQGVHLICYSQGS
LHCYPFVSYYPWVCLPSVSLSLLYVQYVYTDYLKWLFPTSMRSNLYRICYSPWGQEFSIC
NYWHDPHHDDLYLNASSFLALINGERDHPNATVWRKNFLRVGHLVLIGGPDDGVITPWQS
SFFGFYDANETVLEMEEQLVYLRDSFGLKTLLARGAIVRCPMAGISHTAWHSNRTLYETC
IEPWLS
Download sequence
Identical sequences ENSMMUP00000011288 9544.ENSMMUP00000011288 ENSMMUP00000011288

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]