SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000011337 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000011337
Domain Number 1 Region: 663-938
Classification Level Classification E-value
Superfamily SAICAR synthase-like 1.7e-83
Family Inositol polyphosphate kinase (IPK) 0.0000000163
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000011337   Gene: ENSMMUG00000008642   Transcript: ENSMMUT00000012084
Sequence length 943
Comment pep:known chromosome:MMUL_1:1:143623937:143726407:1 gene:ENSMMUG00000008642 transcript:ENSMMUT00000012084 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVYCYALNSLVIMNSANEVKSGGGPGPSGSETPPPPGKAVLSPGSVFSPGRGASFLFPP
VESLSPEEPRSPGGWRSGRRRLNSSSGSGSGSSVSSPSWAGRLRGDGQQVVAAGTLSPPG
PEEAKRKLRILQRELQNVQVNQKVGMFEAHIQAQSSAIQAPRSPRLGRARSPSPCPLRSS
SQPPGRVLVQGARIEERRTKSWGEQCPETSGADSRRKGGPGLCTSQVKEGMPPLPGRGAP
TGSEAWGPFVRMEKGISASPRCDSPTAMEIDKRVSPPPGTRSCLAPSLGLVGASLTMATE
VAARATPTGPHRPQDLALTEPSGRARELEDPQPREALVERQGQFLGSETSPAPERGGPRA
GEPPGKMGKGNLPCGMPGSGAPEVGERPEETTVSVQSAESSDALSWSRLPRALASVGPEE
ARSGAPVGRGRWQLSDRVEGGSPTLGLLGGSPSAQPGTPDVEAGIPSGRMLEPLPCWDTA
KDLKEPQCPPGDRVGVQPGSSRVWQGTMEEVGLAWTCGTGVQSEGTWESQRQDRDAHPSP
ELLPQDQDKPFLREACSPSNIPAVIITDMGTQEDGALEETQGSPRGNLPLRKLSSSSASS
TGFSSSYEDSEEDISSDPERTLDPNSAFLHTLDQQKPRVSKSWRKIKNMVHWSPFVMSFK
KKYPWIQLAGHAGSFKAAANGRILKKHCESEQRCLDRLMVDVLRPFVPAYHGDVVKDGER
YNQMDDLLADFDSPCVMDCKMGIRTYLEEELTKARKKPSLRKDMYQKMIEVDPEAPTEEE
KAQRAVTKPRYMQWRETISSTATLGFRIEGIKKEDGTTFVALSFRPFKSQRHAGRGFSLE
SEEEGNVLIAYRDRLKAIRTTLEVSPFFKCHEVIGSSLLFIHDKKEQAKVWMIDFGKTTP
LPEGQTLQHDVPWQEGNREDGYLSGLNNLIDILTEMSQDAPLA
Download sequence
Identical sequences ENSMMUP00000011337 ENSMMUP00000011337 9544.ENSMMUP00000011337

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]