SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000011346 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000011346
Domain Number 1 Region: 3-144
Classification Level Classification E-value
Superfamily Thiamin pyrophosphokinase, catalytic domain 4.05e-52
Family Thiamin pyrophosphokinase, catalytic domain 0.000000191
Further Details:      
 
Domain Number 2 Region: 147-231
Classification Level Classification E-value
Superfamily Thiamin pyrophosphokinase, substrate-binding domain 9.94e-30
Family Thiamin pyrophosphokinase, substrate-binding domain 0.00000423
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000011346   Gene: ENSMMUG00000008650   Transcript: ENSMMUT00000012094
Sequence length 231
Comment pep:known chromosome:MMUL_1:3:181763139:182078062:-1 gene:ENSMMUG00000008650 transcript:ENSMMUT00000012094 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SLGNLKYCLVILNQPLDNYFRHLWNKALLRACADGGANRLYDITEGERESFLPEFINGDF
DSIRPEVREYYATKGCELISTPDQDHTDFTKCLKVLQKKIEEKDLKVDVIVTLGGLAGRF
DQIMASVNTLFRATHITPFPVIIIQEESLIYLLQPGKHRLHVDTGMEGNWCGLIPVGQPC
TQVTTTGLKWNLKNDVLAFGTLVSTSNTYDGSGVVTVETDHPLLWTMAIKN
Download sequence
Identical sequences ENSMMUP00000011346 9544.ENSMMUP00000011346 ENSMMUP00000011346

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]