SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000011421 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000011421
Domain Number 1 Region: 380-472
Classification Level Classification E-value
Superfamily Immunoglobulin 4.87e-23
Family I set domains 0.0047
Further Details:      
 
Domain Number 2 Region: 263-355
Classification Level Classification E-value
Superfamily Fibronectin type III 3.84e-21
Family Fibronectin type III 0.0023
Further Details:      
 
Domain Number 3 Region: 67-175
Classification Level Classification E-value
Superfamily Fibronectin type III 1.52e-18
Family Fibronectin type III 0.00021
Further Details:      
 
Domain Number 4 Region: 182-270
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000203
Family I set domains 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000011421   Gene: ENSMMUG00000008713   Transcript: ENSMMUT00000012176
Sequence length 477
Comment pep:known chromosome:MMUL_1:1:167258957:167266973:1 gene:ENSMMUG00000008713 transcript:ENSMMUT00000012176 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMEKTTSEDPACSPEETASESAKVPTAEPPGEVAVSESTGEEQVPKPQAPAPQAPAAPVT
TKPAPPSEDVPSAPLLLTLEDVSNSSVTVSWEPPERLGRLGLQGYVLELCREGASEWVPV
SARPMMVTQQTVRNLALGDKLLLRVSAVSSAGAGPPAMLDQPVHIRENIEAPKIRVPRHL
RQTYIRQVGETVNLQIPFQGKPKPQATWTHNGHALDSQRVSVRTGDQDSILFIRSAQRSD
SGRYELTVHVEGLEAKAAIDILVIEKPGPPSSIRLLDVWGCNAALQWTPPQDTGNTELLG
YTVQKADKKTGQWFTVLERYHPTTCTISDLIIGNSYSFRVFSENLCGLSASATITKELAH
IQKTDIAAKPKGFIERDFSEAPSFTQPLADHTSTPGYSTQLFCSVRASPKPKIIWMKNKM
EIQGNPKYRALSEQGVCTLEIRKPSPFDSGVYTCKAINVLGEASVDCRLEVKASATH
Download sequence
Identical sequences F7E1N8
ENSMMUP00000011421 ENSMMUP00000011421 9544.ENSMMUP00000011421

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]