SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000011447 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000011447
Domain Number 1 Region: 777-1076
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 6.67e-84
Family Hect, E3 ligase catalytic domain 0.00000874
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000011447   Gene: ENSMMUG00000008733   Transcript: ENSMMUT00000012204
Sequence length 1083
Comment pep:known chromosome:MMUL_1:3:194246143:194383887:1 gene:ENSMMUG00000008733 transcript:ENSMMUT00000012204 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFSFEGDFKTRPKVSLGGASRKEEKASLLHRTQEERRKREEERRRLKNAIIIQSFIRGYR
DRKQQYSIQRSAFDRCATLSQSGGTFPIANGPNLTLLVRQLLFFYKQNEDSKRLIWLYQN
LIKHSSLFVKQLDGSERLTCLFQIKRLMSLCCRLLQNCNDDSLNVALPMRMLEVFSSEDT
YLPVLQDASYVVSVIEQILHYMIHNGYYRSLYLLINSKLPSSIEYSDLSRVPIAKILLEN
VLKPLHFIYNSCPEGARQQVFTAFTEEFLAAPFTDQIFHFIIPALADAQTVFPYEPFLNA
LLLIESRCSRKSGGAPWLFYFVLTVGENYLGALSEEGLLVYLRVLHTFLSQLPVSPASAS
CHDSASDSEEESEEADKPSSPEDGRLSVSYITEECLKKLDTKQQTNTLLNLVWRDSASEE
VFTTMASVCHTLMVQHRMMVPKVRQVLLYSLAFNARFLRHLWFLISSMSTRMITGSMVPL
LQVISRGSPMSFEDSSRIIPLFYLFSSLFSHSLISIHDNEFFGDPIEVVGQRQSSMMPFT
LEELIMLSRCLRDACLGIIKLAYPETKPEVREEYITAFQSIGVTTSSEMQQCIQMEQKRW
IQLFKVITNLVKMLKSRDTRRNFCPPNHWLSEQEDIKADKVTQLYVPASRHVWRFRRMGR
IGPLQSTLDVGLESPPLSVSEERQLAVLTELPFVVPFEERVKVCNLVYLLYLFLQTENHT
LNTVGLPLRNMVLITVALQYGVCVYLFIANGSRTAALLSRGSGKESVYPGYRIIPLYLCL
SEMHCHSPSYFFVQTPSDFKCSSENTCSLRVGFNIKLSIWLFVFRRLALYENMLVELPFA
GFFLSKLLGTSADVDIHHLASLDPEVYKNLLFLKSYEDDVEELGLNFTVVNNDLGEAQVV
ELKFGGKDIPVTSANRIAYIHLVADYRLNRQIRQHCLAFRQGLANVVSLEWLRMFDQQEI
QVLISGAQVPISLEDLKSFTNYSGGYSADHPVIKVFWRVVEGFTDEEKRKLLKFVTSCSR
PPLLGFKELYPAFCIHNGGSDLERLPTASTCMNLLKLPEFYDETLLRSKLLYAIECAAGF
ELS
Download sequence
Identical sequences 9544.ENSMMUP00000034494 ENSMMUP00000034494 ENSMMUP00000011447

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]