SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000011503 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000011503
Domain Number 1 Region: 249-407,737-832
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 2.09e-71
Family beta-sandwich domain of Sec23/24 0.002
Further Details:      
 
Domain Number 2 Region: 499-734
Classification Level Classification E-value
Superfamily vWA-like 6.89e-39
Family Trunk domain of Sec23/24 0.0039
Further Details:      
 
Domain Number 3 Region: 834-938
Classification Level Classification E-value
Superfamily Helical domain of Sec23/24 9.42e-31
Family Helical domain of Sec23/24 0.0069
Further Details:      
 
Domain Number 4 Region: 410-495
Classification Level Classification E-value
Superfamily Zn-finger domain of Sec23/24 1.29e-25
Family Zn-finger domain of Sec23/24 0.00055
Further Details:      
 
Domain Number 5 Region: 939-1082
Classification Level Classification E-value
Superfamily C-terminal, gelsolin-like domain of Sec23/24 3.4e-25
Family C-terminal, gelsolin-like domain of Sec23/24 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000011503   Gene: ENSMMUG00000008780   Transcript: ENSMMUT00000012264
Sequence length 1086
Comment pep:known chromosome:MMUL_1:9:63251021:63275176:-1 gene:ENSMMUG00000008780 transcript:ENSMMUT00000012264 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNVNQSVPPVPSFGQPQPVYPGYHQSSYGGQSGSTAPTIPYGAYNGPVPGYQQTPPQGMS
RAPPSSGAPPASTAQAPCGQAAYGQFGQGDVQNGPSSTVQMQRLPGSQPFGSPLAPVGNQ
PAVLQPYGPPPTSAQVTAQLSGMQISGAVAPAPPSSGLGYGPPTSLASASGSFPNSGLYG
SYPQGQAPPLSQAQGHPGIQTPQRSAPSQASGFTPPASGGPRLPSITGPLLPGQSFGGPS
VSQPNHVSSPPPQALPPGTQMTGPLGPLPPMHSPQQPGYQPQQNGSFGPTRGPQPNYGSP
YPAAPTFGSQSGPQPLPPKRLDPDAIPSPIQVIEDDRNNRGTEPFVTGVRGQVPPLVTTN
FLVKDQGNASPRYIRCTSYNIPCTSDMAKQAQVPLAAVIKPLARLPPEEASPYVVDHGES
GPLRCNRCKAYMCPFMQFIEGGRRFQCCFCSCINDVPPQYFQHLDHTGKRVDAYDRPELS
LGSYEFLATVDYCKNSKFPSPPAFIFMIDVSYNAIRTGLVRLLCEELKSLLDFLPREGGA
EESAIRVGFVTYNKVLHFYNVKSSLAQPQMMVVSDVADMQENRLNLGGRGCSELRSRHSM
PAETLSQKNKNNIKENFLLLILGSRSEVSHEFEYPMLAIQFSNRAELGYLNIFFSPFPFP
TLFQPQTGAYQTLAKECVAQGCCVDLFLFPNQYVDVATLSVVPQLTGGSVYKYACFQVEN
DQERFLSDLRRDVQKVVGFDAVMRVRTSTGIRAVDFFGAFYMSNTTDVELAGLDGDKTVT
VEFKHDDRLNEESGALLQCALLYTSCAGQRRLRIHNLALNCCTQLADLYRNCETDTLINY
MAKFAYRGVLNSPVKAVRDTLITQCAQILACYRKNCASPSSAGQLILPECMKLLPVYLNC
VLKSDVLQPGAEITTDDRAYVRQLVTSMDVAETNVFFYPRLLPLTKSPIESTTEPPAVRA
SEERLSNGDMYLLENGLNLFLWVGASVQQGVVQSLFSVSSFSQITSGLVRARSQGEYGSN
KVSVLVPLNIREHLGTRAVALIVVKQEDKLEMLFKHFLVEDKSLSGGASYVDFLCHMHKE
IRQLLS
Download sequence
Identical sequences ENSMMUP00000011503 ENSMMUP00000011503 9544.ENSMMUP00000011503

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]