SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000011578 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000011578
Domain Number 1 Region: 5-144
Classification Level Classification E-value
Superfamily ENTH/VHS domain 2.04e-46
Family VHS domain 0.0000686
Further Details:      
 
Domain Number 2 Region: 159-221
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 7.67e-21
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0003
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000011578
Domain Number - Region: 407-560
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.00209
Family FCH domain 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000011578   Gene: ENSMMUG00000008833   Transcript: ENSMMUT00000012345
Sequence length 777
Comment pep:known chromosome:MMUL_1:16:77157216:77177289:1 gene:ENSMMUG00000008833 transcript:ENSMMUT00000012345 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGRGSGTFERLLDKATSQLLLETDWESILQICDLIRQGDTQAKYAVNSIKKKVNDKNPHV
ALYALEVMESVVKNCGQTVHDEVANKQTMEELKDLLKRQVEVNVRNKILYLIQAWAHAFR
NEPKYKVVQDTYQIMKVEGHVFPEFKESDAMFAAERAPDWVDAEECHRCRVQFGVMTRKH
HCRACGQIFCGKCSSKYSTIPKFGIEKEVRVCEPCYEQLNRKAEGKATSTTELPPEYLTS
PLSQQSQLPPKRDETALQEEEELQLALALSQSEAEEKERLRQKSTYTSYPKAEPTPSASS
APPASSLYSSPVNSSAPLAEDIDPELARYLNRNYWEKKQEEARKSPTPSAPVPLTEPAAQ
PGEGHAAPATVVENPLPETDSQPIPPSGGPFSEPPFHNGESEESHEQFLKALQNAVTTFV
NRMKSNHMRGRSITNDSAVLSLFQSINGMHPQLLELLNQLDERRLYYEGLQDKLAQIRDA
RGALSALREEHREKLRRAAEEAERQRQIQLAQKLEIMRQKKQEYLEVQRQLAIQRLQEQE
KERQLRLEQQKQTVQMRAQMPAFPLPYAQLQAMPAAGGVLYQPSGPASFPSTFSPAGSVE
GSPMHGVYMSQPAPAAGPYASMPGTAADPSMVSAYMYPAGATGAQAAPQAQAGPTASPAY
SSYQPTPTAGYQNVASQAPQSLPTISQPPQSSTMGYMGSQSVSMGYQPYNMQNLMTTLPS
QDASLPPQQPYIAGQQPMYQQMASSGGPPQQQPPVAQQPQAQGPPAQGSEAQLISFD
Download sequence
Identical sequences A0A2K5UEI6 F7EWU7
9544.ENSMMUP00000011578 NP_001248540.1.72884 XP_005585306.1.63531 ENSMMUP00000011578 ENSMMUP00000011578

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]