SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000011812 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000011812
Domain Number 1 Region: 543-607
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000000222
Family HLH, helix-loop-helix DNA-binding domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000011812   Gene: ENSMMUG00000009017   Transcript: ENSMMUT00000012598
Sequence length 653
Comment pep:known chromosome:MMUL_1:19:1383874:1433435:-1 gene:ENSMMUG00000009017 transcript:ENSMMUT00000012598 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNQPQRMAPVGTDKELSDLLDFSMMFPLPVTNGGRAASLAGAQFGGSGLEDRPSSGSWGS
GDQNSSSFDPSRTFSEGTHFTESHSSLSSSTFLGPGLGGKSGERGAYASFGRDAGVGGLT
QAGFLSGELALSSPGPLSPSGMKGTSQYYPSYSGSSRRRAADGSLDTQPKKVRKVPPGLP
SSVYPPSSGEDYGRDAAAYPSAKTPSSAYPAPFYMADGSLHPSAELWSPPGQAGFGPMLG
GGSSPLPLPPGSGPVGSSGSSSTFAGLHQHERMGYQLHGAEVNGGLPAASSFSSAPGATY
GGVSSHTPPVSGADSLLGSRGTTAGSSGDALGKALASIYSPDHSSNNFSSSPSTPVGSPQ
GLAGTSQWPRAGAPGALSPSYDGGLHGLQSKIEDHLDEAIHVLRSHAVGTAGDMHTLLPG
HGALASGFAGPMSLGGRHAGLVGGGHPEDGLAGSTSLMHNHAALPSQPGALPDLSRPPDS
YSGQGRAGAHVPAAPQQREAPDQTAHPAPGRLGHPELGTANATQGHMSPSPASDSVLSLE
EKDLRDRERRMANNARERVRVRDINEAFRELGRMCQMHLKSDKAQTKLLILQQAVQVILG
LEQQVRERNLNPKAACLKRREEEKVSGVVGDPQMVLSAAHPGLSEAHNPAGHM
Download sequence
Identical sequences 9544.ENSMMUP00000011812 ENSMMUP00000011812 ENSMMUP00000011812

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]