SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000011842 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000011842
Domain Number 1 Region: 335-431
Classification Level Classification E-value
Superfamily Immunoglobulin 8.81e-20
Family I set domains 0.01
Further Details:      
 
Domain Number 2 Region: 496-787
Classification Level Classification E-value
Superfamily 3-carboxy-cis,cis-mucoante lactonizing enzyme 0.00000000000000196
Family 3-carboxy-cis,cis-mucoante lactonizing enzyme 0.046
Further Details:      
 
Domain Number 3 Region: 80-133
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000000166
Family Ovomucoid domain III-like 0.0097
Further Details:      
 
Domain Number 4 Region: 256-347
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000169
Family I set domains 0.091
Further Details:      
 
Domain Number 5 Region: 180-252
Classification Level Classification E-value
Superfamily EF-hand 0.00000000615
Family Calmodulin-like 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000011842   Gene: ENSMMUG00000009033   Transcript: ENSMMUT00000012628
Sequence length 849
Comment pep:known chromosome:MMUL_1:5:153552613:154365449:-1 gene:ENSMMUG00000009033 transcript:ENSMMUT00000012628 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFKCCSVVLVLGFIFLESEGRPTKEGGYGLKSYQPLMRLRHKQEKNQESSRVKGFMIQDG
PFGSCENKYCGLGRHCVIGRETGQAECACMDLCKRHYKPVCGSDGEFYENHCEVHRAACL
KKEKITIVHNEDCFFKGDKCETTEYSKMKNKLLDLQNQKYIMQENENPNDDDISQKKLLV
DQMFKYFDADSNGLVAINELTQVIKQEELGKDLFDCTLYDLLKYDDFNADKHLALEEFYR
AFQVIQLSLPEDQKLSITAATVGQSAVLSCAIQGTLRPPIIWERNNIILNNLDLEDINDF
GDDGSLYITKVTTTHMGNYTCYADGYEQVYQTHIFQVNVPPVIRVYPESQAREPGVTASL
RCHAEGIPKPQLGWLKNGIDITPKLSKQLTLQANGSEVHISNVRYEDTGAYTCIAKNEAG
VDEDISSLFVEDSARKTLANILWREEGLGIGNMFYVFYEDGIKVIQPIECEFQRHIKPSE
KLLGFQAIDEVCPKAEGDEVQSCVWASAVNVKDKFIYVAQPTLDRVLIIDVQSQKVVQAV
STDPVPVKLHYDKSHDQVWVLSWGTLEKTSPTLQVITLASGNVPHHTIHTQPVGKQFDRV
DDFFIPTTTLIITHMRFGFVLHKDEAALQKIDLETMSYIKTINLKDYKCIPQSLAYTHLG
GYYFIGCKPDSTRAVSPQVMVDGVTDSVIGFNSDVTGTPYVSPDGHYLVSINDVKGLVRV
QYITIRGEIQEAFDIHTNLHISDLAFQPSFTEAHQYNIYGSSSTQTDVLFVELSSGKVKM
IKSLKEPLKAEEWPWNQKNRQIQDSGLFGQYLMTPSKDSLFILDGRLNKLNCEITEVEKG
NTVIWVGDA
Download sequence
Identical sequences ENSMMUP00000011842 9544.ENSMMUP00000011842 ENSMMUP00000011842

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]