SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000011850 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000011850
Domain Number 1 Region: 92-178
Classification Level Classification E-value
Superfamily PUA domain-like 1.06e-18
Family PUA domain 0.0039
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000011850
Domain Number - Region: 51-88
Classification Level Classification E-value
Superfamily Pre-PUA domain 0.0981
Family Hypothetical protein APE0525, N-terminal domain 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000011850   Gene: ENSMMUG00000009043   Transcript: ENSMMUT00000012637
Sequence length 181
Comment pep:known chromosome:MMUL_1:X:118814039:118822394:1 gene:ENSMMUG00000009043 transcript:ENSMMUT00000012637 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFXXFDEKENVSNCIQLKTSVIKGIKNQLIEQFPGIEPWLNQIMPKKDPVKIVRCHEHIE
ILTVNGELLFFRQREGPFYPTLRLLHKYPFILPHQQVDKGAIKFVLSGANIMCPGLTSPG
AKLYPAAVDTIVAIMAEGKQHALCVGVMKMSAEDIEKVNKGIGIENIHYLNDGLWHMKTY
K
Download sequence
Identical sequences ENSMMUP00000011850 ENSMMUP00000011850 9544.ENSMMUP00000011850

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]