SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000011931 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000011931
Domain Number 1 Region: 285-607
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex, superhelical domain 8.63e-43
Family Lipovitellin-phosvitin complex, superhelical domain 0.008
Further Details:      
 
Domain Number 2 Region: 28-276
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex; beta-sheet shell regions 2.86e-41
Family Lipovitellin-phosvitin complex; beta-sheet shell regions 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000011931   Gene: ENSMMUG00000009091   Transcript: ENSMMUT00000012722
Sequence length 894
Comment pep:known chromosome:MMUL_1:5:92544753:92591962:1 gene:ENSMMUG00000009091 transcript:ENSMMUT00000012722 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MILLAVLFLCFISSYSASVKGHTTGLSLNNDRLYKLTYSTEVLLDRGKGKLQDSVGYRIS
SNVDVALLWRNPDGDDDQLIQITMKDVSVENVNQQRGAKSIFKGKSPLKIMGKENLEALQ
RPMLLHLIHGKVKEFYSYQNEPVAIENIKRGLASLFQTQLSSGTTNEVDISGNCKVTYQA
HQGKVIKIKALDSCKIARSGFTTPNQVLGVSSKATSVTTYKIEDSFVIAVLAEETHAFGL
NFLQTITGKIVSKQKLELKTTEAGPRLMSGKQAATIIKAVDSKYTAIPIVGQVFQSHCKG
CPSILEHWQSTRKYLQPDSLSKAEAVRNFLAFVQHLRTAKKEEILQILKMESKEVLPQLV
DAVTSAQTSDSLEAILDFLDFKSDSSIILQERFLYACGFASHPDEELLRALISKFKGSIG
SSDIRETVMIIIGTLVRKLCQNEGCKLKAVVEAKKLILGGLEKAEKKEDTRMYLLALKNA
LLPEGIPSLLKYAEAGEGPISHLATTTLQRYDLPFITDEVKKTLNRIYHQNRKVHEKTVR
TTAAAIILNNNPSYMEVKNILLSIGELPQEMNKYMLAIVQDILHFEMPASKIVRRVLKEM
VAHNYDRFSRSGSSSAYTGYIERIPHSASTYSLDILYSGSGILRRSNLNIFQYIGKAGLH
GSQVVIEAQGLEALIAATPDEGEENLDSYAGMSAILFDVQLRPVTFFNGYSDLMSKMLSA
SGDPISVVKGLILLIDHSQELQLQSGLKANIEVQGGLAIDISGAMEFSLWYRESKTRVKN
RVTVVITTDITVDSSFVKAGLETSTETEAGLEFISTVQFSQYPFLVCMQMDKDEAPFRQF
EKKYERLSTGRGYVSQKRKESVLAGCEFPLHQENSEMCKVVFAPQPDSTSSGWF
Download sequence
Identical sequences ENSMMUP00000011931 9544.ENSMMUP00000011931 ENSMMUP00000011931

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]