SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000011934 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000011934
Domain Number 1 Region: 291-383
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 9.78e-25
Family Tudor domain 0.00000298
Further Details:      
 
Domain Number 2 Region: 81-162
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.9e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.00000757
Further Details:      
 
Domain Number 3 Region: 10-80
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 3.51e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000011934   Gene: ENSMMUG00000009096   Transcript: ENSMMUT00000012725
Sequence length 520
Comment pep:known chromosome:MMUL_1:1:130221966:130230410:-1 gene:ENSMMUG00000009096 transcript:ENSMMUT00000012725 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EERLTFVGEDDIEIEMRVPQEAVKLIIGRQGANIKQLRKQTGARIDVDTEDVGDERVLLI
SGFPVQVCKAKAAIHQILTENTPVSEQLSVPQRSVGRIIGRGGETIRSICKASGAKITCD
KESEGTLLLSRLIKISGTQKEVAAAKHLILEKVSEDEELRKRIAHSAETRVPRKQPISVR
REDITEPGGAGEPALWKNTSSSMGPAAPLVTPPPKGGGDMAVVVPKEGSWEKPSDDSFQK
SGAQAIPEMSMFEIPSPDFSFHADEYLEVYVSASEHPNHFWIQIVGSRSLQLDKLVNEMT
QHYENSVPEDLTVHVGDIVAAPLPTNGSWYRARVLGTLENGNLDLYFVDFGDNGDCPLKD
LRALRSDFLSLPFQAIECSLARIAPSGDQWEEEALDEFDRLTHCADWKPLVAKISSYVQT
GISTWPKIYLYDTSNGKKLDIGLELVHKGYAIELPEDIEENRAVPDMLKDMATETDASLS
TLLTETKKNSGEITHTLSCLSLSEAASMSGDDNLEDDYLL
Download sequence
Identical sequences 9544.ENSMMUP00000011934 ENSMMUP00000011934 ENSMMUP00000011934

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]