SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000011953 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000011953
Domain Number 1 Region: 28-118
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000171
Family Glutathione peroxidase-like 0.0061
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000011953
Domain Number - Region: 141-253
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00549
Family PDI-like 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000011953   Gene: ENSMMUG00000009110   Transcript: ENSMMUT00000012746
Sequence length 255
Comment pep:known chromosome:MMUL_1:1:151524103:151524897:1 gene:ENSMMUG00000009110 transcript:ENSMMUT00000012746 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
REVIAGPFLRNDSQFLESSSPERSYIGPYFSAHGCSSCQSLTQVLVESYWKINEAGQNFK
IILVSEDRSEEPFKQYFSESIPYTEEAWRSDPNWLYRIQGIPLIVLDPQDEVSMWRGVEV
LNDEDGWEFPWHPPMLKLSDSNTVQLSGPYLLLFVDSEDDRESQEAKQLIQPIAEKIIAK
CKAKEKESLLFFVPGEDDMIDFLQGYTNPPEAAPLLTTLDMSTLTEYVMDEEITPAIVEA
FVNTFLAEKLNPEPI
Download sequence
Identical sequences ENSMMUP00000011953 ENSMMUP00000011953 9544.ENSMMUP00000011953

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]